KEGG   Schizosaccharomyces pombe (fission yeast): SPBC25H2.12c
Entry
SPBC25H2.12c      CDS       T00076                                 

Symbol
cct7
Name
(RefSeq) chaperonin-containing T-complex eta subunit Cct7
  KO
K09499  T-complex protein 1 subunit eta
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPBC25H2.12c (cct7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC25H2.12c (cct7)
Chaperones and folding catalysts [BR:spo03110]
 Heat shock proteins
  HSP60 / Chaperonin
   SPBC25H2.12c (cct7)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPBC25H2.12c (cct7)
  Exosomal proteins of colorectal cancer cells
   SPBC25H2.12c (cct7)
  Exosomal proteins of bladder cancer cells
   SPBC25H2.12c (cct7)
SSDB
Motif
Pfam: Cpn60_TCP1 Pyr_redox_2
Other DBs
NCBI-GeneID: 2540572
NCBI-ProteinID: NP_596355
PomBase: SPBC25H2.12c
UniProt: P87153
Position
II:join(3260919..3260952,3260995..3261418,3261586..3262804)
AA seq 558 aa
MSLGGPQIPVIVLKEGTDDSQGRGQLLSNINACVAVQDTIRTTLGPLGADKLMVDDRGEV
VISNDGATIMKLLDIVHPAAKTLVDIARAQDAEVGDGTTSVVVFAGELLREARTFVEDGV
SSHLIIRGYRKAAQLAVNKIKEIAIHLDLSDEGKLRDLLTKCASTAMNSKLIRSNSTFFT
KMVVDAVLTLDQEDLNENMIGIKKVPGGAMEDSLLVKGVAFKKTFSYAGFEQQPKFFKNP
KILCLDVELELKAEKDNAEVRVDKVQEYQNIVDAEWRIIFSKLEAIVATGAKVVLSKLPI
GDLATQYFADRDIFCAGRVAADDLNRVVQAVGGSIQSTCSNIEEKHLGTCDTFEERQIGG
DRFNLFEGCPKAKTCTLILRGGADQFIAEVERSLHDAIMIVKHALKNNLVVAGGGACEME
LSKYLRDYSLTISGKQQNFIAAFARSLEVIPRQLCDNAGFDSTNILNKLRMQHAKGEMWA
GVDMDSEGVANNFEKFVWEPSTVKSNAILSATEAATLILSVDETIKNEPSQQPQAPQGAL
PPGAANRIMRGRGRGMPR
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtcgcttggaggtcctcaaattcctgtcattgtactgaaggaaggtacggatgattcc
caaggacggggtcaactgctttcgaacatcaatgcttgtgtcgctgtacaagacacgatc
cgaaccactctcggtccattgggcgctgataagttaatggttgacgatagaggagaagtt
gtaatttcaaatgatggcgcaactattatgaaactcttggacattgtccatcctgctgca
aaaacgctagttgatattgccagagcccaagatgcggaagtcggtgatggtactacttcg
gtcgttgtattcgctggcgaattattgagagaagcgagaacatttgttgaagatggagtt
agttcacatcttattataagaggttatcgtaaagctgcccagttggctgtgaataagatt
aaagagattgctattcacttggatttatcggacgaaggaaaattacgagatctgttaaca
aaatgcgcatctactgcaatgaactcaaagcttattcgttcgaattctactttttttaca
aagatggtagttgatgctgttttgacattagatcaagaagacttgaatgaaaacatgatt
ggtattaaaaaagtccctggaggagcaatggaggattcacttcttgttaagggcgttgca
tttaaaaagacattttcgtatgctggttttgaacaacagccaaaattcttcaagaatccc
aaaattctttgtttggacgttgagttggaattaaaggccgagaaagacaatgctgaagtt
cgcgttgataaagttcaagaataccagaatatcgtcgatgctgaatggcgtatcattttt
tccaaacttgaagcgattgtcgctactggtgcgaaagttgttttgtcaaaattgcccatc
ggtgatttggccacccaatatttcgcggatcgtgacattttttgtgctggaagggttgct
gcagatgatttaaatcgtgtggtacaagcagttggcggctccatccagtctacctgctca
aatattgaggagaagcacctaggtacttgtgatacttttgaggagcgtcaaatcggtggt
gatcgtttcaatctatttgaaggttgtcccaaggccaagacttgcactcttattcttcgt
ggcggtgctgatcagtttattgcagaggtggaacgctcgttacatgatgctattatgatt
gttaaacatgcgttaaaaaataacttagtagtcgctggcggtggtgcttgtgagatggag
ttatctaaatatctccgtgattattctcttactatatctggtaaacaacagaattttata
gctgcctttgctcgctcgttggaagtaatccctcgtcagctgtgtgataatgcaggattc
gattcaacaaatattttgaataaactccgtatgcaacatgccaagggtgaaatgtgggct
ggtgtagatatggatagcgaaggggtcgcaaacaattttgagaagtttgtttgggagcct
agcaccgtcaaatcaaatgccatattatcagcaactgaggcagctactctaattctgtcc
gttgacgagactattaaaaatgaaccttcacagcaacctcaagctccacagggtgcgtta
cctcctggcgctgctaataggattatgcgtggtagaggtcgaggaatgccccgctaa

DBGET integrated database retrieval system