KEGG   Schizosaccharomyces pombe (fission yeast): SPBC25H2.13c
Entry
SPBC25H2.13c      CDS       T00076                                 
Symbol
cdc20
Name
(RefSeq) DNA polymerase epsilon catalytic subunit Pol2
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC25H2.13c (cdc20)
   03410 Base excision repair
    SPBC25H2.13c (cdc20)
   03420 Nucleotide excision repair
    SPBC25H2.13c (cdc20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC25H2.13c (cdc20)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC25H2.13c (cdc20)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SPBC25H2.13c (cdc20)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    SPBC25H2.13c (cdc20)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      SPBC25H2.13c (cdc20)
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 NAPRTase_C
Other DBs
NCBI-GeneID: 2540627
NCBI-ProteinID: NP_596354
PomBase: SPBC25H2.13c
Ensembl: SPBC25H2.13c
UniProt: P87154
Position
II:3253690..3260706
AA seq 2199 aa
MPLKTARGASKYQFRKFNGNYNGKSKSNGRTFAKSTEEVGFNDPMKIVYKKNEIDRMMGF
DSYEGGQPREAWLLNVHPTVIESTKGNSTLSAVDFYFIQDDGDTFRCTIPYSPYFYIAAR
EGKEALVDDYLKKKFVGLIKSTTRIFKEDLQLKNHIVGYQKLYIKLVFDNLNDLQAVRKS
LMSAVKANSSQQDAVDAYTNLSSENLNGIIENAFEDPLNHVLDIREYDVPYHSRTLIDLN
IRVGQWYTVSYHEGHVQISLLASRIERAEPTIMAFDIETTKLPLKFPDSSFDKIMMISYM
IDGQGFLITNREIISQNIEDFHYTPREEFEGPFIIFNEPDEVGLLHRFFKHIRSAKPSVI
VTYNGDFFDWPFVDARAAFHGLNLTEETGFFRDAEDEYKSSYCSHMDAFRWVKRDSYLPQ
GSQGLKAVTVSKLGYNPIELDPELMTPYASEKPQVLAQYSVSDAVATYFLYMKYVHPFIF
SLCNIIPLNPDEVLRKGTGTLCETLLTVEACTKNIILPNKHVDASQKFFDGHLLASETYV
GGHVESLESGVFRSDLPTNFNMDPKVYEELILQLDKALDFSLTVENNVNVDEIENYEEVR
DSILKKLSDLRDRPKRSEKPRIYHLDVASMYPNIMITNRLQPDSVKDESFCATCDLNVPN
KTCDRRMVWAWRGEYYPAKKGEYHMIYSALQSERFPGPTPFSPFRSFQELSPSEQAAMVQ
KRIADYSRKVYHRLYDNTVIERETIICQKENSFYIDTVKSFRDRRYDFKGLQKKWVKQLA
AIKEKGGLAEIEEAKKMVVLYDSLQLAHKVILNSFYGYVMRKGSRWYSIEMAGITCLTGA
TIIQMARQIVERAGRPLELDTDGIWCILPESFPENFEFKKKSGGKVFISYPCVMLNHLVH
EKFTNHQYSALKDPEKLVYETTSENSIFFEVDGPYRAMILPASTEEGKNLKKRYAVFNFD
GSLAELKGFEVKRRGELKLIKDFQSQIFKVFLKGDSLEECYQEVAYVADTWLEILFTKGS
NLTDDELIELISENRSMSKALSEYGSQKSTSITTARRLADFLGDQMTKDKGLACRFIISA
SPKGRPVAERAVPVAIFFAEESVKRHFLRLWLKDNGLYDVDIRDIIDWDYYLKRLGSVVQ
KLISIPAALQRISNPVTRFPLPDWLQKRVAVLNSKYQQKKIDSIFSLAPTNPSTINNTKV
TDIEDLGSVTHKDKRIVARVTKRKLLQQSGNSEAPVSFEVKPVSFMDGYSNWLKYAKKKW
KYQKQVKLRRRHLIGFQSRQFTNVLQSSAEVMFENLWHILQIRETDVPGILHAWVIIRNR
LTSIRFIVNRKFFVCFKDETLPNVEIEGCLIEKSNAILPHGSTSDKLFLLEIPEKSYLTE
KVSISMIFAHPSVSGIYETRIEPIERLILEMGSRKRFNNSVPGALGKGFEFGFESKMFTD
PSDNDVSYLDGVEMNYLYAFHFSISNRFVFSLFMPHLKKVEAIIYDKLPGSDMSFPSISK
IYEELRSKFDNLIKESSIEYPDTLSCNVIFSGNERKAYKLIDEKLLQYFSTKTKNSLLII
ESSLPHILKANVKQIEELPYIMIPRLESNIQSLSWKQHIATKMIQHFLAIGSWLFHRIQL
SRFSDIPLCNFESDDIQYSIDVVYSRKLKEHNIILWWNKGPTPDLGGIEKDSILQIASPK
DPLEVNNPGAYSNACVDISLSNLALCSILNSALINDIEGIGDMAALNDNYMTAINDDLEE
KLGIHDNIGLTHSLPVLKALVKTWWNEAASGNNLADLIIQHLARWISSSKSYLYSPLLSS
HVEVIMRKTFLQLLSEIKRLGAHIIHASANKILIKTSKLIVQNAVTYSNYLLKSIKTLPL
FHFLDLNVTEYWDYLLWMDSVNYGGKMVAANFSATNEEPQTVVSWHIKSHLPPIIQPEFQ
SWIVEFIEEVYKQKLEKSNTKVGFVRVKNNNADEDSEIVGSGILKSKLIHPLKRKVAQVR
RCFQELQLDENTREDLKFPKLPGSFLNYTDGALELVKSICAVFELSHDLNLEVRFLKKSL
LSLLQIQEFSTQAVFRYPSRRLSLDQIPCKQCGVHQDFDLCLHEHLWPTRDDMGTLVFSD
GWSCSSCNLVYDRWVFEETLVDNLYHQLTLYQLQDLICSKCKTVKQWSLKERCSCSGEWV
LQLSPTKFREMLNVYQSVADFYEFSILQNSVQSILSVLN
NT seq 6600 nt   +upstreamnt  +downstreamnt
atgcccttaaaaacagctcgaggagcatccaaatatcagtttaggaaatttaatggtaac
tacaatggaaaaagtaaatcgaacggtaggacgtttgcaaaatcaaccgaggaagttggc
ttcaatgatcctatgaaaattgtctacaaaaagaatgagattgatcgaatgatgggtttt
gatagctatgaaggtggacaaccacgagaagcttggcttctcaacgttcatccaacagta
atcgaaagcaccaaaggcaattctaccctcagtgccgttgacttttacttcattcaagac
gatggtgacactttccggtgtaccattccatactctccttacttctacattgctgctcga
gaaggtaaagaagctttggttgacgattatttaaaaaaaaaatttgtgggcttaattaaa
tctactacgcgtatctttaaagaagatttacagctaaaaaaccacatagtgggttaccaa
aagttgtatataaagttggtttttgataacctgaatgaccttcaggctgtcaggaagtct
ttgatgtctgctgtgaaagctaattcttcccaacaagatgccgttgatgcatacactaac
ttgtcttcggagaatttaaacgggattatagaaaacgcatttgaagatcctttaaatcat
gttttagatatccgtgagtacgatgttccgtatcattctcgtacacttattgatttgaat
attcgagtcggacaatggtatactgtttcatatcatgaaggccatgttcaaatatccctt
ttagcttcccgaatcgagcgtgcagaacctactataatggcttttgatattgaaaccact
aagctgccattgaagtttcctgatagctcgttcgataaaataatgatgatatcttatatg
attgatggccaaggatttttaattaccaatagagaaattatttcccagaatattgaagat
tttcattatactccgagggaggaatttgagggcccatttattatttttaatgagcctgat
gaagttggcctacttcatcgattctttaaacatataaggtctgcaaagccttcagtaata
gttacatacaatggtgacttctttgactggccatttgtagacgcacgtgctgcatttcac
ggattgaatttaacagaagaaactggtttcttcagggacgcagaggatgaatataagtct
tcttattgtagtcatatggatgccttccggtgggtaaagagagatagttatttacctcaa
ggaagtcaaggtctcaaagctgtcactgtcagtaaattaggttataatcctatcgaacta
gatccagaattgatgactccttatgcaagtgaaaaacctcaagttcttgctcaatattca
gtttcagatgctgttgctacttattttctttacatgaaatatgtgcatcctttcattttt
tctctttgtaacattatcccattaaatcctgatgaagttttacgtaaaggcacgggtacg
ttgtgtgaaacgcttttaactgttgaggcttgtacaaaaaatattattcttccgaataaa
catgttgatgctagtcaaaaatttttcgacggtcatttacttgcaagtgagacttatgtt
ggaggacatgttgaaagtcttgaaagtggtgtttttagaagcgacttgccgactaatttc
aacatggatccaaaagtttatgaagaactaattttacagttggacaaagccttagatttt
tctttaacagttgaaaacaacgtcaatgttgatgaaatcgaaaattatgaagaggttaga
gacagcatattaaagaaactaagtgaccttcgtgatcgaccaaaaaggtcggagaagcca
aggatttaccatcttgatgtcgcctcaatgtacccaaatattatgattaccaaccggtta
cagccagattcagtaaaagatgaatcgttttgtgcaacatgcgatcttaatgtgcccaat
aagacatgtgatcgtcggatggtatgggcatggagaggggagtattaccctgctaaaaaa
ggtgaatatcatatgatatattctgctttacaatctgagcgttttccaggccctacccct
ttctcaccttttaggtcatttcaagagctttctccctcagaacaagctgctatggtgcaa
aagcgcattgcggattacagccgtaaagtgtatcaccgtctatatgataataccgttatc
gaaagggaaactataatttgtcaaaaggaaaactcattttatattgatacggtaaaaagc
tttagggatcgccgttatgactttaaaggattgcaaaaaaaatgggtcaaacaacttgct
gctataaaggaaaaaggaggacttgctgaaatagaggaggccaaaaagatggtcgtactc
tacgattctttacagttagctcacaaagttattttaaactctttctatggatatgtcatg
cgaaaaggctcccgttggtattcgattgaaatggctggtatcacatgtttgacaggcgct
acgattattcagatggctcgtcaaatagttgaacgtgcaggtaggccattggaacttgac
acagatggtatttggtgtattcttccagaatcgtttcctgaaaactttgaatttaaaaag
aaatccggaggaaaggtttttatctcttatccatgcgttatgttaaatcacctggttcat
gaaaagttcaccaatcatcaatattctgccttaaaggacccagagaaattggtgtatgaa
acaactagtgaaaacagcattttttttgaggttgatggtccttatagagctatgattttg
cctgcttcaacggaagaaggtaaaaacttaaaaaagcgttatgccgttttcaatttcgat
ggtagtttagctgaacttaaaggctttgaggtgaaaagaagaggagaattgaagctcatt
aaggattttcaatctcagatatttaaagtttttttgaaaggtgattctttagaggaatgc
tatcaagaagttgcctatgttgctgacacttggttagagattctattcaccaaaggctct
aacctaacagatgatgaattaattgaactgatttctgagaatcgtagtatgtctaaagct
ttgtctgaatacggaagccaaaaatcgacatccattactacagccaggcgactggctgac
tttttgggtgatcaaatgaccaaagacaaaggtctagcatgtcgttttattatttccgca
agtccaaaaggaaggccagttgcagaaagggcagtaccggtagctattttctttgctgaa
gaatctgttaagcgacattttcttaggctctggttgaaagataatggtctatatgatgtt
gatattagagacattattgattgggattattatttgaaacgtctaggatcagtagtacaa
aaactaattagcatccctgctgctctccaaaggatttcaaaccccgttacccgttttcca
ttgccggactggcttcaaaaacgagttgctgtcttgaattctaaataccaacagaaaaag
atcgattccattttctccttagcccctacaaatccatccacaataaacaacacaaaagtt
actgatattgaggatttaggaagtgtgactcacaaagataagcgtattgtcgctcgagtt
accaagcgtaaacttttacaacaatctgggaactcggaagcacctgtatcttttgaagta
aaacctgtatcctttatggatggatattcgaattggcttaagtatgctaagaaaaagtgg
aaatatcagaagcaggtcaagcttcgaagaagacatttaattgggtttcaatcaaggcaa
ttcaccaatgttttacaatcttctgctgaagttatgtttgaaaatttatggcatatttta
caaatacgagaaaccgatgttcctggtattttacatgcttgggtaattattcgtaatcgg
ttgacctcgatacggttcattgtgaatagaaagttttttgtatgtttcaaagatgagact
ttaccgaatgttgaaattgagggatgcttaattgaaaaaagcaatgcgatattaccgcat
ggaagcacttcggataagctttttttacttgaaattccagaaaagagctatttaacggaa
aaggtatcaatttctatgatttttgcccatccgtctgttagtggaatatatgagactcgt
atagaaccaattgaaagattgatattagaaatgggatccagaaaaaggtttaataattca
gtacctggagcgttaggtaaaggcttcgaatttggatttgaatctaaaatgttcactgac
ccaagtgataacgatgtttcctatcttgatggagtagagatgaactacctttatgcattc
catttttccattagtaataggtttgttttttcactttttatgccacatttaaaaaaagtt
gaggccataatttatgacaaactgccaggtagtgatatgtctttcccatcaatcagcaaa
atttacgaagagctacggtcgaaatttgataatttaattaaggaaagtagtatcgaatac
cctgatactctttcgtgtaatgtcattttctcgggaaacgaaaggaaagcgtacaaactg
atagatgaaaagttgcttcaatatttttcaactaaaactaaaaatagtctgcttattatt
gaaagttcactccctcacatattgaaggcaaatgtgaagcaaattgaagagcttccgtat
ataatgataccacggcttgagagcaacatacagtctctttcttggaaacaacacattgct
acgaaaatgatccaacatttcttagctattggtagctggcttttccatcgcatacaactt
tctcgcttctcagatatcccattatgcaactttgaaagcgatgacattcagtacagtatc
gatgttgtttactctagaaagctgaaagaacataatattatcctttggtggaataaaggc
ccaactccagacttaggtggtattgagaaggatagtattctgcagattgccagtcccaaa
gatccactagaagttaacaatcctggtgcttattcaaatgcttgtgttgacatttctctt
tccaaccttgcactttgtagcattctcaattctgctctcataaatgacatagaaggtatt
ggcgacatggcagctttgaatgataattacatgaccgccataaatgatgatctggaggaa
aagttgggaatacatgataatattggactgacacattcattgccggtgttgaaggcgttg
gttaaaacttggtggaacgaagctgcatccggtaataatctcgctgatcttataattcaa
catttagcccgatggatttcttcatcaaaatcttatctgtacagtcctttactctcctcg
cacgtggaagttataatgagaaaaacttttttacaacttctctctgagataaaacgcctt
ggagcacatatcatacacgcttctgctaataaaatattaatcaaaacgagcaaattaatc
gtccagaacgctgtcacttattcaaattatttactcaaatccattaagacgttaccacta
tttcactttttggatctaaatgtcacggaatactgggattatcttttatggatggattcc
gttaattatggaggaaaaatggtggcagcaaatttttcagctacaaatgaagaaccacag
acagttgtttcatggcacattaaaagtcatttacctccaatcattcagcccgaatttcag
agttggattgttgagtttattgaagaggtttataagcaaaaattagaaaagtctaataca
aaagttgggtttgttcgcgtgaaaaacaacaatgctgatgaggactctgaaatagttgga
tcgggaattttaaaaagtaagttgatacatcctcttaaacggaaagttgctcaagtaagg
agatgttttcaagagcttcagcttgatgaaaataccagagaagatcttaaatttccaaag
ttgccaggttcttttcttaactatactgatggcgctctagaattggttaaaagcatctgt
gctgtttttgaactctcccatgatctcaatttggaggtccgttttttaaaaaagagttta
ttgtcacttttacaaattcaagagttttccactcaggcggtatttcgatatcctagtcgt
cgactttcacttgatcaaataccctgtaagcagtgtggcgtccatcaggattttgacctt
tgtttacatgagcatctatggcctactcgcgatgacatggggaccttggtgttttctgac
ggatggtcttgttccagctgtaacttagtttacgatcgatgggtgtttgaggaaactttg
gtggataacttataccatcaattgacattatatcaactgcaagatttgatttgttctaaa
tgtaagacagttaagcaatggtcattaaaggaacgctgttcatgcagcggagaatgggta
ttacagctttcacctacaaagtttcgtgaaatgttaaacgtttatcaatctgttgctgat
ttttacgagttttctatattgcaaaattctgttcagtccatactttctgtgctgaactaa

DBGET integrated database retrieval system