KEGG   Schizosaccharomyces pombe (fission yeast): SPBC25H2.16c
Entry
SPBC25H2.16c      CDS       T00076                                 
Name
(RefSeq) putative adaptin
  KO
K12404  ADP-ribosylation factor-binding protein GGA
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC25H2.16c
Membrane trafficking [BR:spo04131]
 Endosome - Golgi transport
  Others
   GGA
    SPBC25H2.16c
SSDB
Motif
Pfam: VHS Alpha_adaptinC2 GAT GGA_N-GAT DUF2321
Other DBs
NCBI-GeneID: 2540570
NCBI-ProteinID: NP_596351
PomBase: SPBC25H2.16c
UniProt: P87157
Position
II:join(3246584..3246620,3246658..3246745,3246799..3246874,3247125..3247362,3247419..3248389,3248433..3248624)
AA seq 533 aa
MSSAKRRLYSLIQNATEPYAFEPDLAVNLDIADLINQTGGNLPREAAFAIVRKVNDRNPT
VAYLALNLLDICVKNCGYAFRLQIASKEFLNELVRRFPERPPSRLNKIQVMILSLIEEWR
KTICRVDRYKEDLGFIRDMHRLLSYKGYTFPEIDKENLAVLSQKSVLKTAEELEKEDREA
MSAKLQELIRRGTPADLAEANKLMKVMAGYDTEQKQKYKEHVLVDLEKVKRKAALFGEML
NEVSESDKLASGDLYDELAYSLKAAQRKVDKILEEMSPEDDSYVTVSDLKSLIASLLTQY
DHLLEGDFSSARTVAADNNSLLQATTESAKSNSKTSANASNTQSAMDLLIDLDIGSDAQS
PSLPASSSQMPTSSFNMESLSQSLLGTVEAPAEVGAISLTESFNSPVSNSSPNVPINNFT
STCAFENSHLNFQITPKSKTRDQVVLLATYTNLSPYDTVENLQSFIAVPKKYNLVLQPQS
GTNLSPLQKDGIYQEMIVTKLLDVTELPVRFKLTYKVNGRSQEYTGQSSIRLL
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgtctagcgctaaaagaagactatacagtttaattcaaaatgcgaccgagccgtacgct
tttgaaccagatctagcggttaatttggatatcgctgatttgattaatcaaactggcgga
aatttgcctcgagaagctgcctttgccattgttcgtaaggtcaatgatcgcaatccaaca
gttgcctatctggctttaaatcttcttgatatttgcgtcaaaaattgtggatatgccttt
cgtttacaaattgcttctaaagaattcttaaacgaattagtaagaagatttccagagcgc
ccaccttctcgcttgaacaaaatccaagtcatgattctttctttaattgaggaatggcgg
aaaaccatttgtcgtgttgatcgttataaagaagacctcggttttattagggatatgcac
cgacttttatcttacaaaggctatacatttcctgaaatcgataaagagaatcttgctgtt
ttaagtcaaaaatctgttctaaaaacagcagaagaacttgaaaaggaagacagagaagct
atgtctgctaaactacaggaactaattcgtcgcggtactccggcagatttggctgaagcc
aacaaacttatgaaagttatggctggttacgacactgagcaaaagcaaaaatataaggaa
catgttctcgtagatttagaaaaagtcaaaagaaaagcagctctgtttggtgaaatgttg
aatgaagtttctgaatccgataaactagccagtggtgatttgtacgatgagctggcctat
tccttgaaggctgctcagcgtaaggttgataagatattagaagaaatgagtccggaagat
gactcttacgtgactgttagcgatttgaaatcgttaatcgcatctttactgacccaatat
gaccacttactggaaggcgatttttcatcagctcgtaccgttgctgccgataacaattcg
cttcttcaagctactactgaatcggcaaagagtaattccaaaacctcggctaatgcatct
aatactcaaagtgccatggatttacttatcgatttagacataggatctgatgctcaatct
ccttctttaccagcctcatcttctcaaatgcctacttcttcttttaatatggaaagtctt
tcgcaaagtcttttgggtactgtcgaagcgcctgccgaagttggtgccatctcgcttact
gaatctttcaattcccccgtgtctaattcatcgcccaatgttcccattaacaattttact
tctacttgcgcatttgaaaactctcacttaaattttcagataacccctaaaagtaaaact
agagatcaagtagttttactggctacttacactaatttaagtccctatgatactgtcgag
aatttacaatcgtttattgcagttcccaagaaatataatcttgtacttcaaccccaatct
ggaactaatctttcacctctccagaaagacggtatttaccaggaaatgattgtgactaag
ttactggatgtcacagaactacctgtacggtttaaactgacttacaaggtaaatggtagg
tcccaagaatacactggtcaatcttcaattaggctactctaa

DBGET integrated database retrieval system