KEGG   Schizosaccharomyces pombe (fission yeast): SPBC26H8.07c
Entry
SPBC26H8.07c      CDS       T00076                                 

Symbol
nda3
Name
(RefSeq) tubulin beta Nda3
  KO
K07375  tubulin beta
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04145  Phagosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    SPBC26H8.07c (nda3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC26H8.07c (nda3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spo04812]
    SPBC26H8.07c (nda3)
   04147 Exosome [BR:spo04147]
    SPBC26H8.07c (nda3)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     SPBC26H8.07c (nda3)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    SPBC26H8.07c (nda3)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC26H8.07c (nda3)
  Exosomal proteins of colorectal cancer cells
   SPBC26H8.07c (nda3)
  Exosomal proteins of bladder cancer cells
   SPBC26H8.07c (nda3)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 2540582
NCBI-ProteinID: NP_596650
PomBase: SPBC26H8.07c
UniProt: P05219
Structure
PDB: 
6S8M 5MLV 5MJS

Position
II:complement(join(3964276..3964577,3964663..3965548,3965638..3965692,3965734..3965775,3965827..3965876,3965913..3965924))
AA seq 448 aa
MREIVHIQAGQCGNQVGAAFWSTIADEHGLDSAGIYHGTSEAQHERLNVYFNEAAGGKYV
PRAVLVDLEPGTMDAVKSGKFGNLFRPDNIIYGQSGAGNIWAKGHYTEGAELADAVLDVV
RREAEACDALQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRMMATFSVAPAPKSSDTVV
EPYNATLSMHQLVENSDETFCIDNEALSSIFANTLKIKSPSYDDLNHLVSAVMAGVTTSF
RFPGELNSDLRKLAVNMVPFPRLHFFMVGFAPLAAIGSSSFQAVSVPELTQQMFDANNMM
VAADPRHGRYLTVAALFRGKVSMKEVDEQIRSVQTKNSAYFVEWIPDNVLKAVCSVPPKD
LKMSATFIGNSTSIQEIFRRLGDQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEAGIDEGDEDYEIEEEKEPLEY
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcgtgagattgttcatattcaagctggtcaatgcggaaaccaagtcggtgcggccttt
tggtctaccattgctgatgagcatggtttggattcagctggaatatatcatggaacttct
gaggcacaacacgagcgattgaacgtttattttaacgaggccgctggtggaaagtatgtt
ccccgcgcagtccttgttgatttagagcccggtactatggatgccgtgaagtcaggaaag
tttggaaatcttttccgcccggacaatattatttatggacaatctggtgccggaaatatt
tgggctaaaggccattacactgaaggtgctgaattggccgatgctgttttggacgttgtt
cgccgtgaagctgaagcatgtgatgctttacaaggtttccaattaactcactctttgggt
ggtggtactggatctggtatgggtactcttttactttcgaagattcgcgaggaatatccg
gaccgtatgatggctaccttctccgttgctcctgctcctaaaagctctgataccgttgtg
gaaccttacaatgctactctttctatgcatcaattggtagagaactctgacgaaacattt
tgcattgataatgaggctctttcttcaattttcgctaacacgttgaaaatcaagagtcct
tcatacgatgacttgaaccatcttgtctctgctgtaatggctggtgtaaccacatctttc
cgattccctggtgaattgaactctgacttgcgtaaattagctgttaatatggttcccttc
cctcgtttacactttttcatggtaggatttgctcctcttgccgccatcggttcaagctca
tttcaagctgtttctgtgcccgagcttactcaacaaatgtttgatgctaataatatgatg
gtcgccgctgatcctcgccatggccgttacttaacagttgccgctcttttccgtggtaaa
gtctcaatgaaagaagtcgacgagcaaattcgctctgttcaaactaagaattcagcatat
ttcgttgagtggattcccgataatgtcctcaaagctgtttgttccgttcctcctaaggat
ctcaagatgtctgcaacttttattggtaacagtacttctatccaagaaattttccgtcgt
ttgggtgatcagttttctgcaatgtttagaagaaaagcctttttgcattggtatactggt
gaaggcatggacgaaatggagtttactgaggctgaatctaatatgaatgacttggttagc
gaatatcaacaataccaggaggctggtatcgatgagggtgatgaagattatgaaattgaa
gaagagaaggagcctctcgagtattaa

DBGET integrated database retrieval system