KEGG   Schizosaccharomyces pombe (fission yeast): SPBC27B12.12c
Entry
SPBC27B12.12c     CDS       T00076                                 

Definition
(RefSeq) putative CorA family magnesium ion transporter
  KO
K16073  magnesium transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC27B12.12c
Transporters [BR:spo02000]
 Other transporters
  Pores ion channels [TC:1]
   SPBC27B12.12c
SSDB
Motif
Pfam: CorA
Other DBs
NCBI-GeneID: 2540298
NCBI-ProteinID: NP_595545
PomBase: SPBC27B12.12c
UniProt: O13657
Position
II:complement(1351331..1353742)
AA seq 803 aa
MSFQQPSNGAQGGNNNALEKTSSNEATSSSSTQVSSLSASGISVSTPRVSPFEPERNMQV
QSSQHLEANVQSPVSSQTTYATPSAYAVPQESEIELHESEMVPQKPKKKKRSRRNRKASR
KKIPATQSSSADMDTLHVCPTCGSCSDSKKPQSNKKHRGRRVKHSPKSTLEVPDGIPDIK
ALSASMGSSSQHASRYNEGRGSFDTLGTHYHLSKSRKSSSSDSLYSVSSMSIKNDSNSDS
LSSSSSSDVSGSDENLPIDKTLYLSVEDPSFMVHPRRPSATKSCSAAVDCPHTTIPKPPY
QSDTDLTELPTKSTAQFSDETFTVQPRLKSTHSSIADNEDREVDSQVDENTRVVEEDVCF
PMQEESHVNKGIDFDELDNFAEEELQKQRQNTDHFRSRQYSTCKPFEPHWNDLSPHDPND
PSSSLHSNNAEKAAEVPLRSSYYSGGRRSVTSMSDSPYRFSFFSSNQNETIHASVLSDLL
DDGATSFRSLFCPEKGVWWLDCLDPTDIEMRVLSKAFSIHPLTTEDIRVQEAREKVELFG
SYYFVCFRSFEQDPELANYLEPLNMYIVVFREGLLTFHFSSATHPASVRRRARQLRDYVH
VSSDWLCYALIDDITDAFVPLIRGIETETEAIEDSVLVGRSEDSSDMLRRIGECRKKTMG
MFRLLYGKADVIKMLAKRCNEKWTIAPTGEIGLYLGDIQDHLVTMTSNLSQFEKILSRTH
SNYLAQLTSNSIEENSRTNGALGKITLIGTLLVPMNLVTGLFGMNVPVPGRDTNNLAWFF
GILGVLLGSIAIGWIITMRYNAF
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgtcttttcaacaaccttccaacggagctcaaggaggaaacaacaatgcattagagaaa
acctcctccaacgaagctacttcttcttcgtccacccaggtttcgtccctctctgcaagt
ggcatttcggtaagtactcctcgtgtttctccatttgaacctgagagaaatatgcaggtt
caatcatctcagcatcttgaagcaaatgtgcaaagtcccgtttcgtctcagacaacttat
gccactccttctgcatatgccgtacctcaggagtctgaaatagaacttcatgaatctgaa
atggtgcctcaaaagcccaagaaaaagaagcgttctcgaaggaatcgcaaagcatccagg
aagaaaatacccgccactcagagttcctctgctgatatggacacgttgcatgtttgcccg
acatgcggttcttgttcggattcaaagaaaccacagtcgaacaagaaacatcgtggtaga
cgtgtcaaacacagcccaaagtctaccctggaggtacctgatggtattccggatatcaaa
gctttatctgcttccatgggttcctcttctcaacatgcaagccgctataacgaaggtcgc
ggaagttttgatactctcggtacacattaccatcttagcaaaagtcgtaaatcttcctca
agcgattctctttattcggtgtcctctatgagtataaagaatgattcaaattctgattcg
ttatcttcgagttcttcttccgatgtttctggcagtgacgaaaatttacctatagacaag
acattgtacctctctgtcgaggatccttcatttatggttcatccccgtagacctagtgct
accaagtcttgctccgccgcggtagactgtccgcacaccactattccaaaacccccctac
cagtcggatacagatctcaccgaacttccaacgaagtccactgctcagttttccgatgag
acgtttactgttcaaccaagacttaagagcacacattcttctattgcagacaatgaggac
cgtgaagttgattctcaagtcgatgagaatacacgggtcgttgaggaagatgtgtgcttt
cctatgcaagaagaatcgcatgtcaataagggaattgatttcgatgaacttgacaatttc
gcagaagaggaacttcaaaaacaaaggcagaatactgatcactttcgctctaggcaatat
agtacttgtaagccttttgagcctcactggaatgacttaagtccacacgatcctaatgat
ccctctagctccttgcactccaataatgcagaaaaagctgcagaggttcctcttcggtct
tcttactattccggcgggagacgatctgttacttctatgtcggattctccctatcggttt
agtttcttttcatctaatcaaaatgaaactatccatgcatctgtattatcggatttactg
gatgacggggcgactagtttccgctccttattttgtccagagaagggtgtttggtggttg
gattgtttagatcctactgatatagaaatgcgtgtactttcgaaggcattctcgattcat
cctttgactacagaagatattcgtgttcaggaagcaagagaaaaagttgagcttttcggt
tcctactatttcgtttgttttcgatcttttgaacaggatcccgagctagccaactatttg
gagcctttgaacatgtatatcgttgtttttagagagggcttgttaaccttccactttagt
tcagctacccatccagcttctgtgcgacgtcgtgctcgacaacttcgagattatgtgcat
gtttcctctgactggctttgttacgccctcattgatgacattacggatgcatttgttccg
ttgatccgtggtattgaaactgaaaccgaggctattgaagactcggtacttgttgggcgt
agtgaagattcttctgatatgttgagacgaattggtgaatgtcgcaaaaagacaatggga
atgttccgacttttatatggaaaggcagatgttattaaaatgctcgctaagagatgcaat
gaaaaatggactattgcccctactggtgaaattggtctttaccttggagacattcaagac
catttagtcaccatgacttccaacctttcccagtttgagaaaatcttgtcacgcacacac
agtaattaccttgcacaattgacctcaaattcaatcgaagagaattctcgcactaacggt
gccttaggtaaaattacccttattggtactttgcttgttcccatgaacttggtcaccggt
ttattcggcatgaacgttccagtccctggaagagatactaacaatttggcttggttcttt
ggtattctgggtgtgttattgggttcaattgcaattggctggattattactatgcgatac
aatgccttttaa

DBGET integrated database retrieval system