KEGG   Schizosaccharomyces pombe (fission yeast): SPBC28E12.01c
Entry
SPBC28E12.01c     CDS       T00076                                 

Gene name
apc13
Definition
(RefSeq) anaphase-promoting complex subunit Apc13
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 2540285
NCBI-ProteinID: NP_595754
PomBase: SPBC28E12.01c
UniProt: O74358
Position
II:complement(1834888..1835295)
AA seq 135 aa
MDSNYNYVHMNKPGVVLFASDWLKDRLPVDDVEVRVEHLPPVTEDEMTIQHSSANLILMK
NKQLRHEPAWKDLELEDLVNAFAFIQGSSNAEGKNTIEDNFETDPFKSVKEAPMAPFLEA
NRRHQGEHASMRYFR
NT seq 408 nt   +upstreamnt  +downstreamnt
atggattcgaattacaattatgttcatatgaataaaccgggagtagttttgtttgcctcg
gattggctaaaagatagacttccagttgacgatgtcgaagtgcgagtagaacacttacca
cctgttacagaagatgagatgactattcaacattctagtgcaaatctaatcttaatgaaa
aacaaacagcttaggcatgaaccggcttggaaagatttggaactcgaagatttagttaat
gcctttgcattcattcaaggctcttcaaatgccgagggtaaaaatacaattgaagataat
tttgaaacagatcctttcaaatcagtcaaagaagctccaatggctccttttcttgaagcg
aacagaaggcatcaaggagagcacgctagtatgcggtattttagatga

DBGET integrated database retrieval system