KEGG   Schizosaccharomyces pombe (fission yeast): SPBC29A10.05
Entry
SPBC29A10.05      CDS       T00076                                 
Symbol
exo1
Name
(RefSeq) exonuclease I Exo1
  KO
K10746  exonuclease 1 [EC:3.1.-.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SPBC29A10.05 (exo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC29A10.05 (exo1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC29A10.05 (exo1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     SPBC29A10.05 (exo1)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    SPBC29A10.05 (exo1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     SPBC29A10.05 (exo1)
SSDB
Motif
Pfam: XPG_N XPG_I XPG_I_2
Other DBs
NCBI-GeneID: 2540348
NCBI-ProteinID: NP_596050
PomBase: SPBC29A10.05
Ensembl: SPBC29A10.05
UniProt: P53695
Position
II:2545502..2547971
AA seq 571 aa
MGIKGLLGLLKPMQKSSHVEEFSGKTLGVDGYVWLHKAVFTCAHELAFNKETDKYLKYAI
HQALMLQYYGVKPLIVFDGGPLPCKASTEQKRKERRQEAFELGKKLWDEGKKSQAIMQFS
RCVDVTPEMAWKLIIALREHGIESIVAPYEADAQLVYLEKENIIDGIITEDSDMLVFGAQ
TVLFKMDGFGNCITIRRNDIANAQDLNLRLPIEKLRHMAIFSGCDYTDGVAGMGLKTALR
YLQKYPEPRAAIRAMRLDKSLKVPVSFEKEFALADLAFRHQRVYCPKDKTLVHLSPPERE
LSVHEDAFIGSFFDNQLAIDIAEGRSNPITKCAFDIKDSSMQSFTKTTITISKRKGISKT
DISNFFMKSIPPSKRPTKSTSLIDVTNVKVQRTHLANDISSEKQSIKSANEKAYVTPKSN
SLKPGFGKSLSDISNSATKNENVPFLPPRTGVSKYFKLQKNTEKEIDEQVPSQSNNTTPT
SAKSDSASPQNWFSSFSYQTPNSASPPFSSLSHTLPISALAKIGHDALNRKNHASLPSRR
IVYKPPSSPSTPISMNPRPKGILSLQQYKFR
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgggaattaaaggtcttttgggacttttgaagcctatgcagaaaagctctcatgtcgag
gagttttctggcaagactttgggagttgatggatatgtttggttgcacaaggcagtgttt
acatgtgctcatgaattagcatttaacaaggaaaccgataaatacctaaagtatgctatt
catcaggcgttaatgctacaatattatggtgtaaaacctttaatagtattcgatggagga
cctcttccctgtaaagcatcaactgagcaaaaaagaaaagaacgtcgccaagaggcattt
gaacttggtaagaaattgtgggatgaaggtaagaaaagtcaagcaataatgcaattctca
cgctgtgttgatgtgaccccagaaatggcttggaagttaataatcgctttgagagaacat
gggattgaatcaatcgttgctccgtatgaagcagatgctcaactcgtatatttggagaag
gaaaatatcattgatggcattattacggaagactctgatatgctagtttttggcgctcaa
acggtactatttaagatggatggatttgggaattgcataactattagacgtaatgacata
gcaaacgcacaagacttgaatctccgtcttccgattgaaaaacttcgacatatggcaata
ttttccggatgtgattacacagatggtgtagctggaatgggattaaaaactgctttacgt
tatttgcagaaatatcctgaacctcgggcagctattcgtgcaatgagacttgataaaagc
cttaaagttccagtatcttttgaaaaggagtttgcacttgctgacctagcctttcgacat
caacgtgtatattgtccgaaagacaaaactctagttcatctgagtcctcctgaaagggaa
ctttctgtacatgaggatgcatttataggctcattttttgataatcagttggctattgat
atagcagagggaagatctaatccaattacgaaatgtgcttttgatatcaaggattcgtct
atgcaatcatttaccaaaactacaattactattagtaaacgaaagggtatatcaaagacg
gatatttccaacttttttatgaaatctattcctccttctaaacgtcctaccaaaagcacg
agccttattgatgttaccaacgtcaaagtgcaacgaactcatttagcaaatgatatttca
tccgaaaaacaatcaatcaaatctgcgaatgaaaaagcatatgttactccaaaatcaaat
tctttaaaaccaggttttggaaaatcactttccgatatctctaattcagcgacaaagaat
gaaaatgtccctttccttcctccgagaacaggtgttagtaaatattttaaacttcaaaaa
aatactgaaaaagaaattgatgagcaagtacctagtcaatccaacaatacaactccaaca
tctgctaaatcagattctgcttcaccccaaaattggttttcttcattctcttaccaaaca
ccgaattctgcttcacccccgttttcttcactatctcatacactcccaatttcagcactt
gctaaaattggtcatgatgcgttaaaccgcaaaaatcatgcctctcttccgtctcgtcgg
attgtgtataagccaccgtctagtccctcaaccccaatatctatgaatcctagacctaaa
ggaatcctatcacttcagcaatataaatttcgttag

DBGET integrated database retrieval system