KEGG   Schizosaccharomyces pombe (fission yeast): SPBC29A10.09c
Entry
SPBC29A10.09c     CDS       T00076                                 

Definition
(RefSeq) putative CAF1 family ribonuclease
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: CAF1 4HPAD_g_N
Other DBs
NCBI-GeneID: 2540515
NCBI-ProteinID: NP_596054
PomBase: SPBC29A10.09c
UniProt: O94386
Position
II:complement(2555664..2556947)
AA seq 427 aa
MEIHGKNFLETLKELEKHVDSAHYVSIDCEFSGLLRDFNLNNKNTLQDRYELLRKSSIRY
TILQIGITFIYLQNNGKSSCIPVNINVSPLVKDELHLKRDFCSEASSIKFLIQQGFDFNK
QLTEGVPYLSRIEERNLIDKVNERSTDDLTSSILDACDEEILVDARNQIKNWLSSELSHS
TSKYLNITTSNRFIRKAIQSLVKIEFPTLKSYPKRTFLQVRKAIENSTTQCSATSKSELK
EDIASDQLILNNLNLIKQNVGLRHLWDYILKKKKSVVCHNGMADLVYLFSLFEGKVPETI
LEFSELCLSSFKSIYDTKLLYLKSDDLQHVSDGIPTDLLSLVSKISLPPVPSNSSSQRSN
VSLNSLIECPYKSMMSRKRPHEAGKDSYDTALLFVYYVMRTKHSDIQRWQNVLPIHGSFL
DLNKYCS
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagatacatggcaaaaactttttagagacattaaaagaattggagaaacacgtagat
tcagcacactatgtttccattgattgtgaattttccggattattaagagacttcaacctt
aacaacaaaaatactttacaagacagatatgagttactgagaaaaagtagtatacgatac
acaattttacaaattggtataacctttatttatttgcaaaacaatggaaaatcttcgtgt
attcccgtaaatattaacgtaagtcctctagttaaagatgaattgcaccttaagagagac
ttctgctcggaggctagcagtattaagtttctgatacaacaaggttttgattttaataaa
caactgacagagggtgtaccatacttatcacggattgaagaaagaaatttgatcgacaag
gttaatgaaagatcaactgacgacttgaccagctcaattttagatgcttgcgatgaagaa
attcttgttgacgcaagaaatcaaattaagaattggttatcgagcgagttgtcacattcc
acttcaaaatacttgaacattactacctctaatcgttttataagaaaagcaatacaatcc
ctggttaaaattgaatttccaactttaaagagttaccccaaaagaacatttctgcaggtt
cggaaggctattgaaaattcgacaactcaatgctctgccacttcaaaaagcgaactcaaa
gaagatattgcgagcgaccaattaatacttaacaatctaaatttgatcaaacagaatgtt
gggttgcgacatttatgggactatatacttaagaaaaaaaagtcagtagtttgtcacaat
ggcatggcagatttggtgtatttgttttccctttttgaaggaaaagtcccggaaacgata
ttagagttttctgagctttgtttatcatctttcaaatctatatatgacactaaacttctc
tacttgaaatccgatgatcttcaacatgtatcagatgggataccaacggacttactttcc
ttagtttcaaagatatctctaccgccagtaccttctaactcctcatctcaaaggtcaaat
gtttctttaaattcgctgattgaatgtccatataagtcaatgatgagcagaaaacgccca
catgaagcaggaaaagattcatacgacactgctctactatttgtttactacgttatgaga
acaaaacactcggatatacagcgatggcaaaatgttcttccaattcacggtagttttctt
gacctaaataaatattgcagttga

DBGET integrated database retrieval system