KEGG   Schizosaccharomyces pombe (fission yeast): SPBC29A3.02c
Entry
SPBC29A3.02c      CDS       T00076                                 

Gene name
his7
Definition
(RefSeq) phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphohydrolase His7
  KO
K11755  phosphoribosyl-AMP cyclohydrolase / phosphoribosyl-ATP pyrophosphohydrolase [EC:3.5.4.19 3.6.1.31]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00340  Histidine metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SPBC29A3.02c (his7)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     SPBC29A3.02c (his7)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     SPBC29A3.02c (his7)
SSDB
Motif
Pfam: PRA-CH PRA-PH MazG PrpR_N LEDGF
Other DBs
NCBI-GeneID: 2540290
NCBI-ProteinID: NP_595830
PomBase: SPBC29A3.02c
UniProt: O59667
Position
II:complement(2040893..2042146)
AA seq 417 aa
MALLPFFDLTNFESDASEELGWLKYVGRVQTRVFPQHFKDNLEKVRKISETIDVIVDTTA
ELGPEACVNLLNAGALAILVNEEMLNELADISPNRLVLKTDTTDIGKIEKLSQVAGSIQW
IGSAENYPPDFFERASKIIHKAVMPEGGGRTLYLEFPEQPSMEVLKSFSVHSVVPVLSSS
FLTVKPAEEPKKLSLADLILISANTDREDGLFSTLVVNELGIALGLVYSSKESVAESLKT
GTGVYQSRKRGLWYKGASSGAVQHLIHIDVDCDEDCLRFVVYQTGKGFCHLDTLHCFGQA
SGLCQLEKTLIDRKNNAPEGSYTARLFSDPKLLRAKIMEEAEELCDATTKENVIWEMADL
MYFAITRCVGSGVSLNDISRHLDLKHRKVTRRKGDAKVAWQEKLKDKGGVANTSYTA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggctcttttaccattttttgatcttacgaactttgagagtgatgcttctgaagagtta
ggatggcttaagtacgtcggcagagtgcaaacaagagtgtttcctcagcatttcaaagat
aatctcgaaaaagttcgcaaaatttcggaaacgattgatgtgatcgttgacacgactgct
gaacttggaccagaggcctgcgtcaaccttttgaacgctggtgcactcgccatactggtt
aatgaagaaatgctaaacgagttggcagacatctctccgaatcgtttggttttgaagaca
gacactactgatattggaaaaattgaaaaactttcacaagttgctggttctattcaatgg
atcggcagtgctgagaattatccccctgacttttttgaaagagccagcaagatcattcac
aaagctgtaatgcctgagggtggaggccgaactttatatttggagttccccgaacaacca
tctatggaggtactgaaatctttttctgttcactctgtcgttcccgttctgtcaagttct
ttcttgacagtgaagcctgccgaagagcccaagaagttatcattagctgatctcattttg
atatctgccaatactgatcgtgaggatggactattttctactttagtcgtcaatgagctc
ggtattgcacttggtctcgtgtattctagcaaggaaagcgttgctgagtctttgaagact
ggcactggagtttatcaatcccgcaaacgtggcttgtggtacaagggcgcatcttctggt
gctgttcaacacttaattcatattgacgtcgattgtgatgaagactgcttgcgctttgtc
gtctatcaaaccggtaaaggtttttgtcatcttgacaccttgcattgctttggacaagct
tcaggactttgtcagttagaaaagactttaatcgataggaagaataatgctcctgaggga
tcttatactgctcgtttgttctccgacccaaagttattgcgtgcaaaaattatggaggaa
gctgaagagttgtgtgatgctaccaccaaagagaatgttatttgggaaatggctgatttg
atgtactttgccataacccgctgcgtcggttcgggtgttagccttaatgacattagtcgt
catcttgatttgaaacatcgtaaagttacaagaagaaagggagatgctaaagttgcatgg
caagagaaacttaaagacaaaggaggagtggcaaacacgtcttatactgcctga

DBGET integrated database retrieval system