KEGG   Schizosaccharomyces pombe (fission yeast): SPBC29A3.06Help
Entry
SPBC29A3.06       CDS       T00076                                 

Definition
(RefSeq) putative CGI-48 family protein
  KO
K14553  U3 small nucleolar RNA-associated protein 18
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    SPBC29A3.06
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC29A3.06
Ribosome biogenesis [BR:spo03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    SPBC29A3.06
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Coatomer_WDAD MMS1_N
Motif
Other DBs
NCBI-GeneID: 2540529
NCBI-ProteinID: NP_595834
PomBase: SPBC29A3.06
UniProt: P78750
Position
II:join(2048336..2049892,2049894..2049896)
Genome map
AA seq 519 aa AA seqDB search
MEKDTEELELENAVFGNINNFSSFLDKENETFDVMMNEAPELSEDNDAQEDELEKLEDAE
LFMFDTGSADGAKDSVPLDIIAGDNTVKEDEEASNEIPSIWEDSDDERLMISLQDHSRLR
KLRQYEDEDMVNGLQYARRLRTQFERVYPVPEWAKKQDVTEEEDEFNALSEKSVIPKSLK
SLFKSSVSYINQSSKLLAPGTINIKRLKDANFQAPSHSGIRCMSIHPYFPLLLTCGFDRT
LRIYQLDGKVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSR
MYGQENFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSFKIEGVLSDVLFTSD
GSEMLVLSYGAEVWHFNVEQRSVVRRWQVQDGVSTTHFCLDPSNKYLAIGSKSGIVNIYD
LQTSNADAAPKPVTTLDNITFSINSMSFSQDSQVLAIASRGKKDTLRLVHVPSFSVFRNW
PTSATPLGRVTCLAFGKGGELCVGNEAGRVGLWKLAHYD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagatactgaggaattggagctcgaaaatgcggttttcggaaacattaacaat
ttctcttcctttttagataaagagaatgagacttttgatgtgatgatgaacgaagctccc
gaattgagcgaagataacgatgctcaagaagatgaattggaaaagctggaagatgcagag
cttttcatgttcgatactggctcagcagatggagccaaagattctgtacctttagatatt
atagctggagataatacggtgaaggaggacgaagaagctagtaatgaaatcccttcgatt
tgggaagacagcgacgatgagcggttgatgatatctttgcaggaccactcgagattaaga
aaattgcgtcaatatgaagatgaagacatggttaatggtcttcaatacgccagaaggtta
cgaacccagtttgaaagagtttatccagtgcctgaatgggctaaaaagcaagacgtaacc
gaagaagaggatgaatttaatgctttatcggagaaaagtgtcattcctaaatctttgaag
agtctattcaaatcttcagtttcctacataaatcaatcctcaaagcttcttgctcctggt
actatcaacatcaaacggcttaaagatgccaacttccaagcaccttctcacagtggaatt
cgttgtatgtctattcatccttattttcctcttttgcttacttgtggctttgatcgcaca
cttcgcatttatcagcttgatggcaaagtcaatccactggtaacatctttgcatttacgt
tcttcagctcttcaaactgcgttgtttcatccggatggtaaacgagtaatagctgctggt
cggagaaaatacatgtacatttgggatttggagtctgcccaagttcaaaaagttagtcgt
atgtatggacaagagaactttcagccaagtatggaaaggtttcacgtagatccaactggg
aagtacattgctttggaaggaagatctggccatataaatttactgcatgctcttactggt
cagtttgctacaagctttaaaattgaaggtgtactttccgacgttttgttcacttctgac
gggtcggaaatgttggtgcttagttatggtgcggaggtatggcattttaatgttgagcaa
cgttcagtcgttcgtcgttggcaagttcaagatggtgtatctaccactcatttttgtttg
gacccatctaataagtatttggcaattggtagcaagagtggtattgttaatatatatgac
ctccagacatccaatgcggacgctgcaccaaaacctgtcactacattggataatattact
ttcagcataaatagtatgagcttttctcaagatagtcaagttttagctatcgcatctcga
ggaaagaaggatactctacgactcgttcatgttcccagctttagtgtgttccgtaattgg
cccaccagcgctacgcctttaggcagagttacatgcctagcttttggtaagggtggtgag
ttatgtgttggtaatgaagctggaagggttggactttggaaactagctcattatgattga

DBGET integrated database retrieval system