KEGG   Schizosaccharomyces pombe (fission yeast): SPBC29A3.09c
Entry
SPBC29A3.09c      CDS       T00076                                 
Name
(RefSeq) putative AAA family ATPase Gcn20
  KO
K06158  ATP-binding cassette, subfamily F, member 3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spo03012]
    SPBC29A3.09c
Translation factors [BR:spo03012]
 Eukaryotic type
  Initiation factors
   Initiation associated factors
    SPBC29A3.09c
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_30 AAA_18 AAA_22 AAA_29 MMR_HSR1 AAA_16 AAA_14 MeaB RsgA_GTPase AAA_33 AAA_28 Dynamin_N AAA RNA_helicase KAP_NTPase AAA_23 DUF87 ATP-synt_ab DO-GTPase2
Other DBs
NCBI-GeneID: 2540597
NCBI-ProteinID: NP_595837
PomBase: SPBC29A3.09c
UniProt: O59672
Position
II:complement(2054214..2056424)
AA seq 736 aa
MEQVIQNNCSEVDPHVLSYCTGYANDAIKDVDEASDHTISLIRNLLLDAGAREEAVQLIQ
NELEKQFKEREEHLDTLQTNGLVRLKETIRMDSQSEISSTMGLVGEKMELDAVKGRKVES
RVDRRKLEKAERKIRAKWEKRTIKAEYESSKLVQPEQKSYEEFYMAVNPLDLSGSNQGKS
KDIKIDGIDLAFAGHRILTGASLTLAQGRRYGLTGRNGIGKSTLLRALSRREIAIPTHIT
ILHVEQEMTGDDTPALQSVLDADVWRKYLIQDQEKITNRLSTIEKELEELSKDQTADQAI
SRRLERERDELDLRLLDIQNKLSEMDSDRAESRAATILAGLGFTQEMQSHATKTFSGGWR
MRLSLARALFCQPDLLLLDEPSNMLDVPSIAFLSEYLQTYKNIVLVVSHDRSFLNEVATD
IIHQHSERLDYYKGNFSQFYATREERCKNQLREYEKQMEYRKHLQSFIDKFRYNAAKSSE
AQSRIKKLEKLPILEKPQTEEEVEFEFPPVEKISPPILQMSDVNFEYVPGHPILKHVDID
VQMDSRIGVVGPNGAGKSTMLKLLIEQLHPTSGIVSRHPRLRIAYFAQHHVDTLDLNLNA
LSFLAKTFPGKGEEEYRRHLGAFGVSGPLALQKMITLSGGQKSRVAFACLGLQNPHILIL
DEPTNHLDMESMDALTRAVKRFQGGVILVSHDVDFLDKTCTSIWQCDHNVVSKFDGTISQ
YKKFCLSQQPTMTIKT
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggagcaagtcattcagaataattgctctgaagtagaccctcatgtcctcagctactgc
actggatatgctaatgatgctattaaagatgtagatgaggcttcagaccatacgatctct
ctcattcgtaatttattgctagatgctggcgctcgtgaggaagcggtacagctcatacaa
aacgaactagagaaacaatttaaagaaagagaggaacatctagatacattacaaacgaat
ggacttgttcgtttgaaggagactattcgaatggattcccaatccgaaatttcgtcaact
atgggtttggttggcgaaaagatggaattagatgctgtaaagggccgtaaggttgaatct
agggtagatagaagaaaattagagaaggctgaacggaagattcgtgccaaatgggagaaa
cgtactatcaaagcagaatacgaatcttcaaagttggttcaacccgaacaaaagtcttat
gaagagttttacatggctgtaaatcctctagatttatccggaagtaaccaaggaaaatcg
aaagatattaaaattgatggaattgatcttgcttttgctggtcatcgtatattgactggt
gcttcgttgacacttgcacagggtagacgatacggtttaactggtcgcaacggtatcggt
aaatctactcttctacgtgctctttctcgccgtgaaattgcgattcctacccatattacc
attcttcatgttgagcaagaaatgacaggtgatgatacacctgccctacagtcagttttg
gatgccgatgtttggcgcaagtatttgattcaggaccaggaaaagataactaatcgtcta
tcaacgattgaaaaagaattggaagaacttagtaaagaccaaactgctgatcaagctatt
tcccgtcgccttgagcgtgaacgagacgaacttgatttacggttgttagatattcaaaat
aagctttccgagatggactctgatagagcagaatcacgcgctgctactattttagctggt
cttggatttactcaagaaatgcaaagccatgctaccaagactttttcaggtggttggcgt
atgcgtttgtcattggcacgtgctctgttttgtcaaccagatttactacttttggatgaa
ccttcgaacatgcttgacgttccctcaattgctttcttatctgaatatttacaaacttat
aaaaatatcgttttagtcgtttcacacgatcgttctttcttgaatgaagttgctactgat
attattcatcaacactctgagcgcttggattactataagggtaattttagtcaattctat
gctactcgtgaagaacgttgcaaaaatcaacttcgtgaatatgaaaagcaaatggaatac
cgcaaacatttgcaatcattcattgacaaatttcgttataatgctgccaaatcatccgaa
gcacaaagtcgtattaagaagttggaaaaactgccgatccttgaaaagcctcaaactgag
gaagaagttgagtttgaatttccacctgtggaaaaaatatctcctcctatcttacaaatg
tctgatgtcaattttgagtatgttccaggtcaccctattctcaaacatgttgatattgat
gttcaaatggattctcgtatcggtgtggttggtcccaacggtgctggtaaatcaacaatg
cttaagcttcttatcgaacaacttcatccaacatctggtatagttagtcggcacccccga
cttcgtattgcatactttgcacaacatcatgtcgatactttggacttaaacttgaatgcc
ttaagctttttagctaagacatttcctggcaaaggtgaagaagaataccgtcgtcatctt
ggcgcttttggtgttagtggacctcttgcattgcaaaaaatgatcacgctttctggtggt
cagaaatctcgtgttgcgttcgcatgcctaggtctacaaaaccctcacattcttattcta
gatgaacccaccaaccatctggatatggagtccatggatgccttgacaagagctgttaaa
cgcttccaaggtggtgtgattcttgtttctcacgatgttgatttcttggacaagacatgt
accagtatttggcagtgtgaccataatgtcgtctccaagtttgatggaacaatttcacaa
tataagaaattctgtctatctcaacagccaaccatgactataaaaacttaa

DBGET integrated database retrieval system