KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2A9.08c
Entry
SPBC2A9.08c       CDS       T00076                                 

Gene name
sec22
Definition
(RefSeq) putative SNARE protein Sec22
  KO
K08517  vesicle transport protein SEC22
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04130  SNARE interactions in vesicular transport
spo04145  Phagosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    SPBC2A9.08c (sec22)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    SPBC2A9.08c (sec22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC2A9.08c (sec22)
Membrane trafficking [BR:spo04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    SPBC2A9.08c (sec22)
SSDB
Motif
Pfam: Longin Synaptobrevin Syntaxin_2
Other DBs
NCBI-GeneID: 2540308
NCBI-ProteinID: NP_596218
PomBase: SPBC2A9.08c
UniProt: Q9Y7L0
Position
II:complement(join(2961668..2961972,2962036..2962199,2962265..2962409,2962619..2962652))
AA seq 215 aa
MVKSTTVTRLDGLPLAASVDDESTERNLESHKKQAKLILKRLSPTSEKRASIESGDYTFH
YLIDNGICYLCICEQSYPRKLAFSYLEELAGEFWNSFGEEALQPGLRPYAFVQFDTFMQK
SKRVYNTPRANDNLDKLNTELKDVTRVMTKNIEDLLYRGDSLEKMADLSSDLRYSSAKYK
KAARRVNLEALWRQYGPVSIIALLFLIFVYWRFFA
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtaaaatctaccacagttactagacttgatggtcttccgcttgccgctagcgtggat
gatgaatcaacagaaagaaatttggaaagccataagaaacaagccaaattgatccttaaa
agactaagtcctacatcggaaaaaagggcttctattgagtctggtgattatacatttcat
tatctcatcgacaacggaatatgttatttatgtatttgcgaacagtcgtatcctcgaaaa
ttagcgttttcgtatctggaagaacttgcaggcgagttttggaatagtttcggcgaagaa
gcattacaacctggattacgtccttatgcatttgttcaatttgacacctttatgcaaaaa
tcaaaaagagtttataataccccgcgtgccaatgataaccttgataaactcaacactgag
ctgaaagatgtaacccgtgtcatgaccaagaatattgaagatttactgtatcgaggtgat
tccttagaaaaaatggcggatctcagttcagatttgcgttactctagtgccaagtacaaa
aaagcggctcgtcgcgttaacttggaagcactttggaggcagtacggccctgtttcgatt
attgcccttttgtttctgatttttgtctattggcgttttttcgcttga

DBGET integrated database retrieval system