KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2D10.04
Entry
SPBC2D10.04       CDS       T00076                                 
Name
(RefSeq) arrestin Aly1-like protein
  KO
K20061  arrestin-related trafficking adapter 3/6
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC2D10.04
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    SPBC2D10.04
SSDB
Motif
Pfam: Arrestin_C Arrestin_N
Other DBs
NCBI-GeneID: 2540410
NCBI-ProteinID: NP_596223
PomBase: SPBC2D10.04
UniProt: O74798
Position
II:2972196..2974172
AA seq 658 aa
MRGELNIPALSRFGKSISASLHHQNGSSRDDNDSNPYENRSSNSGLNRRNSVFGLPSSGL
SSRLSKPSLSSINNSNNSSSNTGGNVLPNPALTPVRNMSNKPPLTWSPSSANLFGTSKVT
SIIGNNVSDVVPPVIKKALASSHGGGMSLSIVLLEPVLYLAGFDLNECQIENPALLRGAL
VLRVAKPANIRGISLSFTGRSRTEWPEGIPVKGHDTYEDKVIISHNWKFYEPTMKDADAP
QHGADVARLVGEQLPLPSSAAASLRGYSVFAPGEYTYNFDLAIPNCFPESVEAKMGWVRY
FLEATVERFGTFKSNLNGRTPVQLVRTPSPASLSSSELINISRDWDERLHYELQVSGKSF
RLGEVVPITFRFLLLDKVRLYKLSISVVESSEYWCRSRKFHRVDPKRRVLLAERSAKHQN
TDNLFETPDEGDGLSSAVFNFNVALPTCLVKERDRLTFDTTYKYIKVRHRLKALLVLSIE
NTENPEKRKYFEINIETPVRILSCRCVKDSTLLPPYESSSQGDNQVLLPCPCRLATTHVE
PTEVTAFTTQSVLASSAPSAGRPAAAQISRPAQLFRIPSTNPPPFDGDVCPPACNTPPPN
YDELFDVLSSISIQDCETDRANDDTILNNRVRRSGTIREEAPHRSLSRTVSRSFEIPR
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgaggggcgaattgaatattccagcgcttagtcgctttgggaaatcgatatcggcttct
ttacaccaccaaaatggttcttctcgagatgataatgattctaatccttatgaaaaccgt
tccagtaattcgggcctcaatcgtagaaattcagtcttcggccttccatcctccggcttg
tcttctagattaagcaagccgtctctatcatctattaataattcaaataattcctcttcc
aataccggcggcaatgtcttaccaaacccagccctcacgccggtgcgcaacatgagcaac
aaacctcctcttacttggagtccctcgtctgcaaacctgtttggtacgtcaaaagtcacc
tccatcattggaaacaacgtctctgatgttgttcctcctgtaatcaagaaagctcttgcc
tcctctcatggaggtggcatgtcgctttccattgttcttcttgaacccgtcttataccta
gccgggtttgatcttaatgaatgtcaaattgagaaccctgctcttttacgtggtgccctt
gttttgcgtgttgcaaagcctgcaaacattcgtggaatcagcctatcttttactggtcga
tcaagaactgagtggccagagggcattccggttaaagggcatgacacttatgaggataag
gtaattatatctcacaattggaagttctatgaaccaactatgaaagacgctgacgctcct
caacacggtgccgatgtagcacgtctagttggtgagcaattacctcttccttcgtctgct
gccgccagtcttaggggttatagtgtttttgctccaggtgaatatacttataattttgat
ttagctatacccaattgttttcccgaatcggtagaagcaaaaatgggttgggtacgatat
tttctggaagctacagtagaaagatttggcacatttaaaagtaatcttaatggccgtacc
cctgtccaactcgtccgcacaccatctcccgctagtctttcttcctctgagcttattaat
atctcacgtgattgggatgaacgtcttcactatgaattacaggtttctggcaagtcgttt
cgcttaggtgaggtagttcctattacctttagatttttactactcgacaaggttcgctta
tataagttatccatttctgtcgttgaatcaagtgaatactggtgccgaagccgcaaattt
catcgtgttgatcccaaacgtcgtgtgcttcttgcggaacgctctgccaaacatcaaaac
acggataacctgtttgaaacgcctgatgaaggagatggtctttctagcgctgttttcaac
ttcaacgttgctttacctacgtgtttggttaaggagcgtgatcgtcttacctttgacact
acttacaagtatatcaaagttcgacacagactgaaggcattgttagtcttgtctattgaa
aacacggaaaatccggaaaagcgaaaatattttgaaataaatattgagactcctgttcga
attttgtcatgtcgttgtgtgaaagattcgacactgcttccgccttacgaatcatcaagc
caaggcgacaatcaagttttgcttccgtgtccatgtagactagctacgactcatgtcgag
ccaactgaagtaacagcttttaccacacaatcggttttagctagttcggcgccttctgct
ggtagaccagctgcagcccaaatttcgcgaccagctcagttgttccgtattccgtctaca
aatccacctccttttgatggggatgtttgtccccctgcttgtaacacacctcctcctaat
tatgatgagttgtttgacgttttgagttcaatcagcattcaggattgcgaaactgatcgt
gctaacgatgacactatcttgaacaatcgtgttcgacggagtggtaccattcgagaagag
gctcctcatcggtcgttgtctcgaactgttagtcgaagctttgaaatccctaggtaa

DBGET integrated database retrieval system