KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2D10.10c
Entry
SPBC2D10.10c      CDS       T00076                                 

Gene name
fib1
Definition
(RefSeq) fibrillarin
  KO
K14563  rRNA 2'-O-methyltransferase fibrillarin [EC:2.1.1.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    SPBC2D10.10c (fib1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC2D10.10c (fib1)
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SPBC2D10.10c (fib1)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    SPBC2D10.10c (fib1)
SSDB
Motif
Pfam: Fibrillarin GCD14 Methyltr_RsmB-F FtsJ PCMT
Other DBs
NCBI-GeneID: 2540479
NCBI-ProteinID: NP_596229
PomBase: SPBC2D10.10c
UniProt: P35551
Position
II:complement(2982764..2983681)
AA seq 305 aa
MAYTPGSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGS
SGGRGGAKGGAKVIIEPHRHAGVFIARGKEDLLVTRNLVPGESVYNEKRISVDSPDGTKV
EYRVWNPFRSKLAAGILGGLDNIYIKPGARVLYLGAANGTSVSHVADVVGPEGLVYAVEF
SHRSGRDLLNMAKKRTNVIPIVEDARHVQKYRMLVGMVDVVFADVAQPDQARIVALNAAA
FLKNEGGVVISVKASCIDSTADAAVVFAREVKKMQEEKIKPQEQLTLEPYERDHCIIVGK
YLRHQ
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcatatacaccaggttcaagaggtggacgaggtggctctagaggaggccgtggtggt
ttcaatggtggccgtggtggtttcggcggtggccgtggaggtgccagaggaggaggacgc
ggtggtgctcgtggcggtcgtggcggtcgtggaggtgccagaggaggccgcggtggttct
agcggtggccgtggtggagccaaaggaggtgctaaagttattattgagcctcatcgtcat
gcaggtgtcttcattgctcgcggaaaagaagatttgcttgtcacccgcaatctggtgcct
ggtgaatcagtatacaatgaaaaacgtattagcgttgattccccagatggtaccaaagtt
gaataccgtgtatggaatcctttccgttctaaacttgccgcaggtattttgggcggttta
gacaacatctatattaaacctggtgcacgtgttttatatcttggtgctgctaacggtaca
tccgtttctcacgttgctgatgttgttggtcctgagggtcttgtctacgctgttgagttt
tctcatcgttctggacgtgatcttcttaacatggctaaaaagcgcacgaatgtcatcccc
attgttgaggatgctcgccatgttcaaaagtatcgtatgttagtcggaatggttgacgtt
gtttttgcagacgttgctcaacccgatcaggctcgtatcgttgctttgaacgccgccgcc
tttttgaaaaacgaaggtggagttgttatctctgttaaggcttcttgtattgattctacc
gctgatgcagctgttgtttttgctcgtgaggttaagaaaatgcaagaggaaaagattaaa
cctcaagaacaacttactttagagccttacgaacgtgatcactgtatcatcgtaggaaaa
tacttgagacatcagtaa

DBGET integrated database retrieval system