KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2D10.12
Entry
SPBC2D10.12       CDS       T00076                                 
Symbol
rhp23
Name
(RefSeq) UV excision repair protein rhp23
  KO
K10839  UV excision repair protein RAD23
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC2D10.12 (rhp23)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC2D10.12 (rhp23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:spo03051]
    SPBC2D10.12 (rhp23)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC2D10.12 (rhp23)
Proteasome [BR:spo03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    SPBC2D10.12 (rhp23)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      SPBC2D10.12 (rhp23)
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD Dsc3_N Rad60-SLD_2 Ubiquitin_5 MCM_N TBK1_ULD EAD1 DUF3135
Other DBs
NCBI-GeneID: 2540481
NCBI-ProteinID: NP_596231
PomBase: SPBC2D10.12
Ensembl: SPBC2D10.12
UniProt: O74803
Position
II:2986871..2988489
AA seq 368 aa
MNLTFKNLQQQKFVISDVSADTKISELKEKIQTQQNYEVERQKLIYSGRILADDKTVGEY
NIKEQDFIVCMVSRPKTSTSTPKSAASPAPNPPASVPEKKVEAPSSTVAESTSTTQTVAA
AAPSNPDTTATSEAPIDANTLAVGAQRNVAVENMVEMGYERSEVERAMRAAFNNPDRAVE
YLLTGIPEDILNRQREESAAALAAQQQQSEALAPTSTGQPANLFEQAALSENENQEQPSN
TVGDDPLGFLRSIPQFQQLRQIVQQNPQMLETILQQIGQGDPALAQAITQNPEAFLQLLA
EGAEGESALPSGGIQIQITQEESESIDRLCQLGFDRNIVIQAYLACDKNEELAANYLFEH
GHESEDEP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaatttgacattcaaaaatctacagcagcagaaatttgttatttctgatgtttctgca
gataccaaaatttcagaattaaaagaaaaaattcaaacgcaacagaattatgaagtcgaa
cgtcaaaagttaatttactcaggtcgaatccttgctgatgacaaaactgttggcgaatac
aatataaaagaacaggatttcattgtatgcatggtttcacgacccaaaacttccacctct
actccgaaatcagctgccagtcctgcccccaatcctccggcttccgtacctgaaaagaaa
gttgaagctccttcttctaccgtggcggaatctacctctactacacaaactgttgctgct
gctgccccttcaaacccagatactactgccactagtgaagcaccaatagacgccaacaca
ttggcagttggtgctcaacgaaatgttgctgtcgaaaatatggtagaaatgggatacgaa
cgcagcgaagttgaaagagccatgcgtgccgcttttaacaaccctgatcgggcagtggaa
tacttattaactggtattcccgaagacattctcaatcgacagagagaagagagtgctgca
gcccttgctgctcagcaacagcaaagcgaagcccttgctcctacttccactggccagcca
gcgaatctttttgaacaagctgctttatcagaaaatgaaaatcaagaacaaccttctaat
accgttggtgatgaccctctaggcttccttcgtagcattcctcaatttcaacagctaaga
caaattgttcaacaaaatccacagatgttggaaactatattgcaacaaattgggcaggga
gatcctgcattggctcaagctattacgcaaaatcctgaagcatttttgcaattattggcg
gagggtgccgaaggcgagtctgccttaccttctggtggaattcagattcaaattactcaa
gaagaatctgagagtattgatagattatgtcaacttggcttcgacagaaacattgtaatt
caggcttatttagcttgtgataaaaatgaagagcttgctgctaattaccttttcgagcat
ggacatgaatctgaggatgaaccttaa

DBGET integrated database retrieval system