KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2D10.17
Entry
SPBC2D10.17       CDS       T00076                                 

Gene name
clr1
Definition
(RefSeq) cryptic loci regulator Clr1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: FOXP-CC
Other DBs
NCBI-GeneID: 2540558
NCBI-ProteinID: NP_596236
PomBase: SPBC2D10.17
UniProt: O74808
Structure
PDB: 
5IKJ 5IKF

Position
II:2997238..3000954
AA seq 1238 aa
MAEPDISSSETLTELQQLRLLYFFCFYHAAPFNVKTLVHSLIPPGALSYLLSTYDILRPW
LMALRVREGPVNDISTIVQLYEEIVKTGFFINPPPFESYSQTLVARITTLGRPKLQVQQE
AQSEVYQRASTNTQQQVSNVSHGNFKPNSSVNTEPNTSILSNSKYAGIKPFDFQSSSQNP
GLVCEQKTFYQHQFRPFSNLPSNKSSPVKHVSPNVKNNSKKTASSVNSNHSSIPSSITKS
NISSLDVYGSEKLISSGSQQPGHGMVQTTSDKVNASASLYDRSPSKKDITSSRNTSSYNL
GSMRNPSTLKNAAHANPFEGLRFQGSSAVLKEGLNSTVKKTFFDNLNSEKVCPSVSPFLT
PDNIASSILYSTASFSRSKPDRPRLNLSLELKLMQNELNKGQLKKQFKGDLRNLADWNNL
SLVSSKFPSLPITNLRPDGSFLKHRRFNEEIAYNRQTLEKAIKQLDLSPDKVIQLREQNG
VAVNGRVCYPTRNKHSEISAQSSSSLGVTKSLASEVYSSSTVDTISKLNTDKDNYLIKSK
KEPIQQKSVSSETTLVKPSSTSSYIDTTNNVLKTNSSFKSSGLTSGPRNEKELLPEGIPT
SHNNSETQAQTADVSNIAASADGIYNSDQEKPPEKLDVTKRAFGREIENSNEKELLTSTF
LSPSAESQVCLAEIKTIRPGLVPKKQFSVDQNNVISDNTDCSLPKPSNSKLSSISSDGDA
SSNRMAVPDKSPFVHAAPNSKALTKDSFSTHISVSSLLHSDNEISPIDSTRKDYFTSKDS
NLQTLKEDASSTKQAKDSGTNDFDKLISGNDVSKNNSGEEQSRSALKPLISGKLSSCESI
NLTKDISTVKRKEYFGIESTSSKQPFHDTGSIKIPAKRSFDTIDKDFRSSNIPFADKIKE
DGGDKNVISSIHITTELPKSMPVEVPTNAGAQSDQSNVVDSESLNLRENISTSVADVSLS
QAGNEAVLSKKACKPLVLIDPFEEKVLKAFNMLSKGYAEYRCQWEGCLANLHSLENFIKH
VLLLHHPKSCSVVKCLWASCDMVLPSEEFEMHLRGHLNNIRLNCEVSNCKKCFSNYEDMF
KHLQHSHLPFKFTPESFIKIRNGNVKEEARRTRNAYTQKSGEVECFMETCTPIAKPAPAN
WYPVPPPGFNSSLLSRLTQSNQSKDKIIAALAKRNVYKSFAGLYDSKGKNDNTGYDFDSN
YARVGRHGSFILPVSKSVPTPSLLIEGSIVQRKNIKIE
NT seq 3717 nt   +upstreamnt  +downstreamnt
atggcggaacctgatatcagttcttcagagacattgacagaattgcaacaactcagactc
ctatattttttctgcttttatcatgctgctccattcaatgtgaaaactctggttcattca
cttattccacctggcgctttatcatatttattgtcgacgtatgatattttgcgtccatgg
ttgatggctttacgagtcagggagggtccagtcaacgatatatctacaattgttcaattg
tatgaggaaattgtaaaaactgggttcttcattaatccccctccattcgaatcgtactca
cagacattagtagctcggataactactttgggtcgcccaaagctacaggtgcaacaggaa
gctcaatctgaagtttatcaacgggcttcaacaaatacacaacaacaagtctccaatgta
tctcatggtaatttcaaacccaattcttcggtaaatacagaacctaacacttcaatttta
tcaaattctaaatatgctggtattaaaccattcgactttcagagttcatcacaaaatcct
ggattggtttgcgaacaaaaaacattttatcagcatcaatttcgtcctttttctaatctc
ccatctaataagtctagcccggttaaacacgtatctccaaatgtcaaaaataattcaaag
aaaactgcttcctcagtcaactctaatcattcttctattccgtcttctataactaagtcc
aatatatcttctttagatgtgtatggttcagaaaagcttatttcctcgggaagccaacag
ccagggcatggtatggtgcaaacaacttccgataaagttaacgcgtcagcatctctttat
gaccgctcaccttcaaaaaaagatatcacaagttcccgtaatacgtcttcttataatctt
ggaagtatgcgaaacccttcaaccttaaaaaatgcagctcatgcaaacccttttgaagga
ctgcgtttccaaggctcttcagcagtgcttaaagaggggcttaactctactgttaagaaa
acattttttgataatttaaactctgaaaaggtgtgtccatctgtttctccgtttttaaca
cctgataatattgcatcctcaatcctatactctacagcgtctttctctcgatcaaaacct
gatagaccgagacttaatttatcattggagctaaagctaatgcaaaacgaactaaataaa
ggtcaattgaaaaaacaattcaaaggcgatttgcgtaacctggccgattggaataatctt
tcgttagtgtcctcgaagttcccttcattgccaattactaacctgcgaccggatggctct
tttttgaaacataggcggtttaatgaagagattgcttacaaccgccaaactcttgaaaaa
gctataaaacagctagacttatctcctgataaagtcattcaacttcgtgaacaaaatggt
gttgcagttaacggacgtgtatgctatcctacgagaaataaacactcggaaatctctgct
caatcaagctcttcgttaggagttactaaatctctggcgtcggaagtgtattcctcttca
actgtcgacaccattagtaaacttaatactgataaggataattatttgattaaaagcaaa
aaggaaccaatacaacaaaaatctgttagctcggaaactactttggtgaaaccgtcatca
acttcttcctacattgacacaactaacaatgtcttgaaaacgaattctagttttaagtcg
tctggtttgacaagtgggcctagaaatgaaaaggaattattgcctgagggaattccgaca
tctcataataattctgaaactcaagctcaaacagctgacgtatcaaacatagcagcttcc
gccgatggaatatataattctgatcaggaaaaacctcctgagaagctggacgttacaaag
agagcttttggacgtgaaatagaaaattcgaatgaaaaagaattattgactagcacattt
ttaagtccttctgcagaatctcaggtttgtcttgcagaaataaaaaccatacgtccggga
ttggttcctaaaaagcagttttctgtggatcaaaataatgtaataagtgacaatacggac
tgttcgcttcctaaaccatctaactctaagctctccagtattagtagcgatggggatgct
tctagcaatcgaatggctgtacccgataagtctccttttgttcatgctgcaccaaattct
aaagcattgacgaaggatagtttttctactcacattagcgtttcatctcttcttcatagt
gacaacgagatttctcctatcgattcaactcgtaaagattactttacttcaaaggacagc
aatcttcagactcttaaagaagatgcgtcttcaacaaaacaggctaaagattctggtact
aatgattttgacaaactgatatctggcaatgatgtatctaaaaacaattctggcgaagaa
caaagcagaagcgcattgaagccactaatttctgggaaactatcaagttgtgagtcgatc
aacttaaccaaggatatttcaactgttaagcgcaaagagtattttggaattgaatcgacg
tcctcaaaacaacctttccatgatactggttcaattaaaatcccagcaaaaagatctttt
gataccattgataaagattttagaagttctaatattccatttgccgacaaaattaaagag
gacggtggagataaaaatgtgatttcctcaattcatattacaactgagcttcctaaatca
atgcccgttgaagtacctactaatgctggtgctcaaagcgatcaaagcaatgtcgttgac
tccgagtctttgaatttgcgtgagaatatttctacgagcgttgctgacgtgagccttagt
caagcagggaacgaagcagtgcttagtaaaaaggcttgtaaaccgcttgtgttaattgac
ccctttgaggagaaagtacttaaagcctttaacatgttgagtaaaggttatgctgaatac
cgttgtcaatgggagggttgtttagccaatcttcattcgttggaaaattttataaaacac
gttttattgttacatcatccgaaaagttgttctgtggttaaatgcctatgggcttcgtgt
gatatggttttgccatcagaagagtttgaaatgcatttgcgcggccatttgaacaacatc
cggcttaattgtgaagtttctaactgtaaaaagtgcttttctaattatgaagatatgttc
aaacatttgcagcattcacatttacctttcaagttcacaccagagtctttcattaaaatt
cgaaatggcaatgtcaaagaagaagcacgtcgtacaagaaatgcttacacacagaagtct
ggtgaagtagaatgttttatggaaacttgtacaccgatagctaaacctgctcctgcgaat
tggtatccggttcctccacctggttttaactcatctttactttccagactaacccaaagc
aatcagtctaaagataaaattatagctgctttagctaagaggaatgtttataaatcattt
gcgggtttgtacgatagtaaaggtaaaaatgataatactgggtacgattttgattcaaat
tatgcccgggttggtcgtcatggttcttttattttacctgtcagcaaaagtgtccctact
ccatccttgctaatcgaagggtctattgtgcaacgtaaaaatataaaaatagaatga

DBGET integrated database retrieval system