KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2G2.08Help
Entry
SPBC2G2.08        CDS       T00076                                 

Gene name
ade9
Definition
(RefSeq) trifunctional formate-tetrahydrofolate ligase/methenyltetrahydrofolate cyclohydrolase/methylenetetrahydrofolate dehydrogenase
  KO
K00288  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase / formyltetrahydrofolate synthetase [EC:1.5.1.5 3.5.4.9 6.3.4.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00670  One carbon pool by folate
spo01100  Metabolic pathways
Module
spo_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPBC2G2.08 (ade9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC2G2.08 (ade9)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SPBC2G2.08 (ade9)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SPBC2G2.08 (ade9)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SPBC2G2.08 (ade9)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC2G2.08 (ade9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 2540300
NCBI-ProteinID: NP_596437
PomBase: SPBC2G2.08
UniProt: O43007
Position
II:join(3448967..3449103,3449371..3452152)
Genome map
AA seq 972 aa AA seqDB search
MNVMVSFNQLRNYFLESNSLRPSKWLFQSYGTSSSANILNGKLLARKLQRSVAEEVQALK
AKDRNFKPALAIVQVGKREDSNVYVRMKEKAARLVGIDFKYCPFPETIQMPALLHELKKL
NDDHTVHGVLVQLPLPKHLNERTVTESITPPKDVDGFGAFNIGLLAKNDATPIHYPCTPK
GIMELLKDNKISVAGLNAVVLGRSDIVGNPISYLLRKDNATVTVCHSKTKDLIQHISNAD
LVIAALGKPEFVRGEWLKPGSVVVDVGINAVQRNGKRVLVGDVHFESASKVASSITPVPG
GVGPMTVAMLMENIVNAAKIARTENIYRKIDLNPLELKKPVPSDIEIANSQEPKLISNLA
KEMGIYDTELENYGNYKAKVNLAVYERLKHRKDGNYVVVSGITPTPFGEGKSTVVAGLVQ
AMGHLGKLGIACVRQPSQGPTFGVKGGAAGGGYAQFIPMDDFNLHMTGDIHAVTAANNLL
VAALETRMFHENTQSDAALIKRLIPVKNGRRVIPRGLIGRWNRICASHNMDPEDVNNASP
ELLKEFVRLNVDPDTIECNRVLDVNDRFLRSIEVGKASTEKGHVRKTSFDISVASECMSI
LALSCDLNDMHSRLSRMVIANDKYGNAITAGDLGVSGALTVLLKDAIKPNLMQTLEGTPA
FVHAGPFANISIGASSIIADKIALKLAGTESFDRPEDAGYVVTEAGFASDMGMEKFFNIK
CRYSKLVPNTVVLVTTVKALKLHGGGPKLKPGAPIPEEYLVENLDLVKNGCSNMVKHIQN
CHKFNIPVVVAINSYKTDSSKEHEIIREAALQAGAVDAVPSDHWAQGGKGAIELAKSVMT
ACDQSSNSKFRLLYDSETSIEDKVNVIAKEMYGANGVEFSSLAKERINTFIKQGFGNLPI
CMAKTQYSLSHNPEFRNVPKNFTVPIRDMRLNAGAGFIYPLAAEIQTIPGLPTAPAYLNI
DICENGEIVGLS
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaatggtttcgtttaatcaattacgaaactattttctagaaagcaacagctta
cggccatcgaaatggctttttcagtcgtatggtacttcaagttctgcgaatatcctaaat
ggaaaattattggcaagaaaattacaacgttctgttgctgaagaagtgcaggccttgaaa
gctaaggatcgaaactttaagccggcgcttgccattgtacaggttggaaaacgtgaggat
tctaacgtgtacgttcgaatgaaagaaaaggcggcacgattagttggtattgattttaaa
tactgcccgtttcctgaaacaatccaaatgcctgccttgcttcatgaattaaaaaaattg
aatgacgatcatacggttcacggtgtccttgtccaacttcctcttcccaagcatctcaat
gagcgtacagttactgaatctatcactccgccgaaagacgttgatggatttggtgcattt
aacattggtttattggcaaagaatgatgctacccccattcattatccctgtaccccgaaa
ggtattatggagttattaaaagataacaagatttcagtcgctggattgaacgctgtagtt
ctgggaagaagtgacattgtcggaaatccaattagctacttgttgagaaaggacaatgct
acagtaactgtctgtcattctaaaactaaagatttaattcagcacatttctaatgctgat
ttggttatagcagcattaggcaaacccgaatttgttcgtggtgaatggttgaaaccagga
tctgttgtggtagatgttggcataaacgctgttcaaagaaatggaaaacgcgttttggtt
ggcgatgtgcatttcgaatctgcatccaaagttgctagcagcattactcctgtccctgga
ggcgtcggaccgatgactgttgctatgctaatggaaaatattgtaaacgctgccaagata
gctagaacagaaaacatttatcgaaaaattgacttaaatcctttagagttaaagaagcct
gttccttctgatatcgaaattgctaattcccaagaacctaaattaattagcaatcttgct
aaggagatgggtatctatgacacagagttagaaaattatgggaactataaggcaaaagta
aatcttgctgtttatgaacgtttaaagcaccgaaaagatgggaactatgttgttgtaagt
ggtattactcctacaccttttggcgaaggtaaaagtacagttgttgctggtttggttcaa
gctatgggccatttgggtaagcttggaattgcttgtgtccgtcagccgtcccaagggccg
acatttggtgttaaaggaggcgccgctggtggaggctacgcacaatttattcctatggat
gactttaaccttcatatgactggagatatacacgctgttaccgcagcaaataatctttta
gtcgcggctcttgaaactaggatgtttcatgaaaacacacaatctgatgctgcccttata
aaacgtttgatccctgttaaaaacgggcgaagagtcattccacgaggattgatcggtagg
tggaatcgtatttgcgcatctcataacatggatccagaagatgttaataacgcatcaccg
gaattactgaaagagtttgtgcggctaaacgtagatcctgacaccatcgaatgcaacaga
gtattggacgtcaatgatcgattcctccgttctattgaggttggaaaagcatcaactgaa
aagggacatgtccgtaaaacttctttcgatatctctgtggccagtgaatgcatgtcaatt
ctggctctttcatgtgatttaaacgacatgcattctcgtttatcccgtatggttatagcc
aacgacaaatacggaaatgctattactgctggcgaccttggagtttctggagcattgacc
gttttgcttaaagacgctatcaaacctaacttgatgcaaactttggaaggaacaccagcg
tttgttcacgcaggaccttttgcaaacattagcattggcgcgtcttctattatcgctgat
aaaattgctttaaaattggctggtacagaaagctttgacagacccgaagatgccggctat
gtcgttaccgaagcaggatttgcgtctgacatgggaatggaaaaattctttaacatcaaa
tgtagatactcaaaacttgtacctaacaccgttgttttggttaccactgttaaagcgctt
aagttacatggaggcggtcccaagttaaaacctggtgccccaattcctgaggaatatctt
gttgaaaatctagaccttgtaaagaatggatgttccaacatggtaaaacacattcaaaat
tgtcataaattcaatattcctgttgttgtcgccatcaacagttataagactgatagttct
aaggagcatgaaataatacgcgaggcagcgctacaagctggagctgtggatgctgtacct
tcggatcattgggcccaaggcggcaaaggagctattgaattggccaagtccgtaatgacg
gcttgtgatcagtcatccaattcgaagtttaggcttttgtatgatagcgagacttcaatt
gaagataaagtaaatgtgattgcaaaagaaatgtatggagcaaacggtgttgaatttagt
tctctagctaaggaacgaataaatacgtttatcaaacaagggttcggtaacttaccaatt
tgcatggcgaaaacccaatattctctttcgcataatcccgaatttcgcaatgttccaaaa
aattttacagttcctattagagatatgcgtttgaatgctggcgctggcttcatttatccg
ctagctgctgaaatccaaacaattcctggtttaccgactgcgcctgcctatttaaacatt
gatatatgtgaaaatggagaaattgttgggctgtcataa

DBGET integrated database retrieval system