KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2G2.12
Entry
SPBC2G2.12        CDS       T00076                                 

Gene name
hrs1
Definition
(RefSeq) putative histidine--tRNA (His) ligase Hrs1
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPBC2G2.12 (hrs1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPBC2G2.12 (hrs1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPBC2G2.12 (hrs1)
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     SPBC2G2.12 (hrs1)
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   SPBC2G2.12 (hrs1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPBC2G2.12 (hrs1)
 Prokaryotic type
    SPBC2G2.12 (hrs1)
SSDB
Motif
Pfam: tRNA-synt_His WHEP-TRS HGTP_anticodon HGTP_anticodon2 tRNA-synt_2d
Other DBs
NCBI-GeneID: 2540472
NCBI-ProteinID: NP_596441
PomBase: SPBC2G2.12
UniProt: O43011
Position
II:3457165..3458856
AA seq 563 aa
MFVFTKNLFTTKFSSSLLNWRFLRTMADSLVDINERITSQGNLVRSLKSQGASKEDIDKE
VAKLLQLKNLKLGGSEVSGKKKDTSFTLKTPKGTKDWCDKDVVLREHIFSTVTEIFKRHG
GVTLDTPVFELKEILSGKYGEDSKLIYDLKDQGGELCSLRYDLTVPFARWLAMNPKVTSI
KRFHIAKVYRRDQPAMTKGRMREFYQCDFDIAGNYDPMIPDSEALKVLVEALDALEVGNY
TIKLNHRKILDGIFTVCGVPDDKIRTISSAVDKLDKLPWEDVRREMVVEKGLKEEVADKI
KEYVLLKGDRSLLDKLEADSLLSSNSSAVAAFNDMRLLFDYLEAFGVLDRFSFDMSLARG
LDYYTGIIYEAVTEASAPKIKSSAEKKKSADPEADRSNDDSIGVGSIAAGGRYDNLVGMF
AAKKNAKIPCVGISLGLERIFSILRSKIPDEDIRANDVDVFVMAFGGGKEWTGFLKERMS
VCKDLWANGIKAEFLYKVKPKPRQQFDAADKFDVPFAVILGQDEFAKGSVRIKQMGLKEN
SDEGQLVPREEMVSVLKKLLKYD
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgtttgtttttaccaaaaacctattcaccaccaaattttcgtctagcctcttaaattgg
cgtttcttgagaactatggctgattctctagtagatataaatgaaagaataacttcacaa
ggaaatcttgttcgatctttgaaaagtcaaggcgcctctaaagaggacattgataaagaa
gttgctaaattacttcaactgaaaaacctcaaacttgggggttcggaagtatcaggaaag
aaaaaagacacatcttttacactgaaaactccgaagggtactaaagattggtgtgacaaa
gatgttgttttacgtgagcacattttttcaactgtcacagagatattcaagcgtcatggt
ggtgtaacactcgatacgccagtgttcgaattgaaagaaattctttccggaaaatatgga
gaagacagcaagctaatttacgatttgaaagatcaaggtggagagctttgttctttgaga
tacgacttgactgttccatttgctcgttggttagctatgaatcccaaagttacgagtatt
aagcgattccatattgcaaaggtttatcgaagagatcagccagctatgacaaaaggccgt
atgcgtgaattttatcaatgcgattttgatatcgctggcaactacgatcctatgattccc
gattctgaagctttaaaggttttagtggaagcattagatgcattagaagttggaaattat
actatcaagcttaatcatcgaaaaattttggatggcatttttactgtttgtggtgtaccg
gatgacaaaattcgtaccatttccagtgctgtggacaagctagataaactcccttgggaa
gatgtcagacgtgaaatggtggttgaaaaaggacttaaagaggaggtggcagataaaatt
aaggagtatgtgttattaaaaggcgaccgctctcttttagataagcttgaagccgatagt
ttactatcaagcaatagctcggctgttgctgcatttaacgacatgcgtcttttatttgat
tatttggaagcttttggagtgttagataggttttcatttgatatgtctctagcgcgtggt
ctcgattattatactggtatcatttacgaagcagtaacagaggcttctgctccaaagatt
aagagttcggcggaaaagaaaaaatctgctgatcctgaagcagatcgttccaatgatgac
tctattggcgttggttcgattgctgctggtggacgttatgacaatttagttggaatgttt
gctgcaaagaaaaacgccaaaatcccttgtgttggcattagccttggtttagagaggatt
ttttcaattcttagatcaaaaattcctgatgaggatatccgtgcaaatgatgttgatgtt
ttcgttatggcatttggaggtggaaaagaatggaccggctttttgaaagagcgtatgtct
gtttgtaaagacctttgggcaaatggcattaaagcagaatttctttacaaagtgaaaccc
aaaccacgtcaacaatttgacgccgccgataaattcgacgtaccttttgctgtaattttg
ggtcaagatgagtttgcaaagggatctgttcgtattaaacaaatgggtttaaaagaaaat
agcgatgaaggtcagcttgtgccacgtgaggaaatggtatcagttttgaaaaagttactt
aaatacgattaa

DBGET integrated database retrieval system