KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2G5.06c
Entry
SPBC2G5.06c       CDS       T00076                                 

Gene name
hmt2
Definition
(RefSeq) sulfide-quinone oxidoreductase
  KO
K22470  eukaryotic sulfide quinone oxidoreductase [EC:1.8.5.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00920  Sulfur metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SPBC2G5.06c (hmt2)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.8  eukaryotic sulfide quinone oxidoreductase
     SPBC2G5.06c (hmt2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 DAO Malic_M
Other DBs
NCBI-GeneID: 2540326
NCBI-ProteinID: NP_596067
PomBase: SPBC2G5.06c
UniProt: O94284
Position
II:complement(2589100..2590479)
AA seq 459 aa
MLTLNSTIKSVTGSFQSASMLARFASTHHKVLVVGGGSAGISVAHQIYNKFSKYRFANDQ
GKDTSLKPGEIGIVDGAKYHYYQPGWTLTGAGLSSVAKTRRELASLVPADKFKLHPEFVK
SLHPRENKIVTQSGQEISYDYLVMAAGIYTDFGRIKGLTEALDDPNTPVVTIYSEKYADA
VYPWIEKTKSGNAIFTQPSGVLKCAGAPQKIMWMAEDYWRRHKVRSNIDVSFYTGMPTLF
SVKRYSDALLRQNEQLHRNVKINYKDELVEVKGSERKAVFKNLNDGSLFERPFDLLHAVP
SMRSHEFIAKSDLADKSGFVAVDQSTTQSTKFPNVFAIGDCSGLPTSKTYAAITAQAPVM
VHNLWSFVNGKNLTASYNGYTSCPLLTGYGKLILAEFLYKQEPKESFGRFSRFLDQTVPR
RMFYHLKKDFFPFVYWNFAVRNGKWYGSRGLIPPHFPVN
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgttgaccttaaactcaacaatcaagtcggtcaccggctcatttcagtccgcttccatg
ttggctcgattcgcctctacccatcacaaggttttagtagttggtggtggatccgctggt
atatccgtcgcccatcaaatttacaacaagttttctaaataccgctttgccaatgaccaa
ggcaaagatacatccctcaaacccggtgaaattggtattgtggatggtgccaagtatcat
tattaccaacctggttggactttgactggtgctggattgagttctgttgctaagaccaga
cgagaattggctagcctggttcctgctgacaaatttaaactccatcctgaatttgttaaa
tccttacatcctcgtgaaaacaaaatagttactcaaagtggtcaagaaattagctatgat
tatttggttatggcagctggtatttatactgactttggcagaatcaagggtttaactgag
gctttggatgaccccaacacccctgtagttactatctattcagaaaaatatgctgacgct
gtttatccttggattgaaaaaaccaagtctggaaatgccatttttactcaacccagcggt
gtcttgaagtgtgccggcgctccacaaaagattatgtggatggctgaagattattggcgt
cgtcataaagttcgttccaatattgatgtatccttctacactggtatgcctactcttttc
tcggttaagcgctattctgatgcccttcttcgccaaaatgagcaattacatcgcaatgtc
aagattaattataaagatgagcttgttgaagttaagggatctgaacgtaaagccgtattt
aagaatttaaacgatggctctctcttcgagcgtccttttgatcttttgcatgccgtcccc
tctatgcgttctcatgagtttatcgcaaagagtgatttggctgataaatctggttttgtt
gctgttgatcaatctactacacaatcgaccaagttccccaatgttttcgctatcggtgat
tgcagtggtttgccaactagtaagacttacgctgccattactgcacaagctcctgttatg
gtccacaatctttggagtttcgttaatggaaagaatttaactgcatcatacaatggttac
acttcatgcccgctactcactggctatggtaagcttatcttggccgaattcttgtacaaa
caagaacctaaagaatctttcggtcgcttttctcgtttccttgaccaaactgtacctcgt
cgcatgttttatcaccttaagaaggacttctttccttttgtttactggaatttcgccgtc
cgcaatggtaagtggtatggcagcagaggtttgattcctcctcactttcctgttaattaa

DBGET integrated database retrieval system