KEGG   Schizosaccharomyces pombe (fission yeast): SPBC30B4.07c
Entry
SPBC30B4.07c      CDS       T00076                                 
Symbol
tfb4
Name
(RefSeq) transcription factor TFIIH complex subunit Tfb4
  KO
K03143  transcription initiation factor TFIIH subunit 3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPBC30B4.07c (tfb4)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC30B4.07c (tfb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBC30B4.07c (tfb4)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC30B4.07c (tfb4)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPBC30B4.07c (tfb4)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPBC30B4.07c (tfb4)
SSDB
Motif
Pfam: Tfb4
Other DBs
NCBI-GeneID: 2540343
NCBI-ProteinID: NP_595532
PomBase: SPBC30B4.07c
Ensembl: SPBC30B4.07c
UniProt: O74366
Position
II:complement(1319070..1320617)
AA seq 297 aa
MDEFQTLKQNASWDISEDANDTPSLLVVILDANPASWYSLSKKVPVSKVLADITVFLNAH
LAFHHDNRVAVLASHSDKVEYLYPSIAPEQKVAEVDPTKEANTYRKFREVDDLVLSGMKR
LMSSTDKVSRKTMISGALSRALAYINQVQNKNTLRSRILIFSLTGDVALQYIPTMNCIFC
AQKKNIPINVCNIEGGTLFLEQAADATGGIYLKVDNPKGLLQYLMMSLFPDQNLRKHLNT
PNQANVDFRATCFCHKKVLDIGFVCSVCLSIFCEPRVHCSTCHTKFTVEPMSKKLHT
NT seq 894 nt   +upstreamnt  +downstreamnt
atggatgaatttcaaactttgaaacaaaatgcctcgtgggatatatctgaagacgcaaat
gatacacccagtttgcttgtagttatattagacgcaaatcctgcctcatggtactccctt
tccaaaaaagtgcctgtttccaaggtactggcagatattacggtttttctaaacgcacac
ttagcttttcatcatgataatagagttgctgtgttagcttcacactcggacaaggttgaa
tacctatacccttcgattgcacctgagcaaaaagtcgcagaagtagatcctaccaaggag
gcaaatacgtatcgaaagtttcgtgaggtagacgacttagttttatctgggatgaagcga
ctcatgagttcgactgataaagtttcaagaaaaacgatgatttccggagcactatctaga
gcccttgcatatatcaatcaagttcaaaataaaaatactcttcgttctcgaattctaatt
ttctcattaactggtgatgttgctcttcagtatattcctactatgaattgtatattttgt
gctcaaaagaaaaatattccaattaacgtttgcaacattgagggaggcaccctgttttta
gaacaagcagcagatgccacaggagggatttacttaaaagttgacaaccccaaaggctta
ctacaatatctcatgatgtcgctttttccggatcaaaatcttcgaaaacacttaaatacc
ccaaaccaagcgaatgttgattttcgagctacatgtttttgccacaaaaaggttttggat
attggctttgtttgctcagtttgtctatcaatattttgtgaaccacgggtgcattgttct
acttgtcataccaaattcacggtagaacctatgtcaaaaaaattgcacacttga

DBGET integrated database retrieval system