KEGG   Schizosaccharomyces pombe (fission yeast): SPBC30D10.07c
Entry
SPBC30D10.07c     CDS       T00076                                 

Definition
(RefSeq) putative biotin-protein ligase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00780  Biotin metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SPBC30D10.07c
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     SPBC30D10.07c
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     SPBC30D10.07c
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     SPBC30D10.07c
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     SPBC30D10.07c
SSDB
Motif
Pfam: BPL_N BPL_LplA_LipB BPL_C GATase_3
Other DBs
NCBI-GeneID: 2540476
NCBI-ProteinID: NP_596278
PomBase: SPBC30D10.07c
UniProt: O14353
Position
II:3086128..3088023
AA seq 631 aa
MNVLIYNGNGASKICLLRTFQSLLPFVVPLYAMRFVDASTLEKEPWPASTALLVMPGGRD
MGYCSSFNETIYRKITDFVKRGGAYLGLCAGGYFGSAVVDFRMPDSDLNVVGKRKLQFFP
GTCAGPTFPGFTYDSEDGARRASIIVDGMQSSPVHTHIYFNGGGSFLETENYSNVKVVAR
YQETDFEKSAAIIYVKVGKGNVVLTGIHPEFSAEGSPILDKRDEKTRLELLSYILKLLGL
KVPKDTSKCGQPTLTDQYLFPNNVETKRFIEKALTNKVKNQDEDTLYTFQFSDISSEIPE
HQLANLDISADLSDSDNEIVKIWYGDEEKICKKAKPSFDLELYAKLINGCRFGLPIIVAP
VIRSTQTLLDKNYRFLDSTNTGFTVLGNYQTAGRGRGQNMWVSPYGTLAFSFIINVDAKN
FSTTPIALFQYLMALAVVRGIREYAPGYENIPAFIKWPNDVYVRVDKGGINFQGKQYMKL
SGIIVTSNYRKNVLHLVVGCGINVSNLGPTVSLNTLVDEWNKNSDNPRLEKFSFEKLLAS
VLNQFDRYHRLLLEEGFSLILPEYYQYWLHSNQTVNLASGGKAIIQGITSDFGFLLAQLL
NENNEPTTKVVHLQPDGNSFDLMRNLITRKT
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaatgttttaatatacaatggcaatggggcctccaaaatatgcctactgagaacattt
caatcccttttaccatttgtcgttccgctatatgcaatgagatttgtcgacgcctctact
ttagaaaaagaaccttggcctgctagcacagctttgttagttatgcccggcggaagagat
atgggttactgttcttcttttaatgaaacaatttaccggaaaattactgattttgtcaag
cgagggggagcttatctgggtttatgtgcaggaggatattttggttctgcggtggttgat
tttcgaatgccagactctgatttgaacgttgtagggaaaaggaaacttcaattttttcca
ggaacttgtgctggtcctacctttcctggatttacctatgatagcgaggatggggcgcga
cgggcatctataattgttgatggcatgcaatcatcccccgttcatacccacatatatttt
aatggaggtgggtcttttttggagacagaaaactattctaatgttaaggtggttgctcgc
tatcaagagacagattttgagaaatcagcagctataatttatgttaaagtaggaaaggga
aacgttgtacttacaggtattcatcctgagttttcagcagagggaagccccattttagat
aaaagagatgagaaaacacgattagaattgttatcctatattctcaaactccttgggttg
aaggttcctaaggatacatctaaatgtggtcagcctacattaactgatcagtacttgttc
ccgaataatgtggagactaaaagatttattgaaaaagctcttacaaataaggtaaaaaat
caagatgaggacactctgtataccttccagttttccgacataagttctgaaatcccggag
catcaacttgctaatttggatatttccgccgatttgtcagattctgataatgaaattgta
aaaatatggtatggtgacgaagaaaaaatatgcaaaaaagcgaagcctagttttgattta
gagctttatgcaaagttaattaacggatgtcgtttcggtttaccaattatagttgcacca
gtaatccggtcaactcaaactctactagacaaaaactatagatttttggattcaacgaat
actggttttaccgtgttgggtaattaccagactgctggtcgaggccgaggtcaaaacatg
tgggtctctccctatggaacgctcgcgttttcgttcatcatcaacgtggatgctaaaaat
ttctctactacacctatagcgctttttcagtatttgatggccttagcagttgtccgtggt
attcgtgagtatgctccaggctatgaaaatattcctgcatttatcaagtggcctaacgat
gtttatgtgcgtgttgataaaggtggaataaattttcaaggtaagcagtatatgaagctt
tctggaatcatagttacttctaattaccgaaaaaatgtcttacatttggttgttggctgt
ggaataaatgtcagtaacttgggtcctactgtttctttgaatactctggtagatgaatgg
aacaaaaactctgataatccgcggctagagaagttttcctttgaaaagctgcttgccagt
gtactcaatcagtttgatcgttatcataggttacttttggaagagggtttttctcttatt
ttaccagaatattaccaatattggttacatagcaaccaaacggtcaatttagcaagcggc
ggtaaagcaataattcaagggattacctctgatttcggatttctgttagctcaactgtta
aacgaaaacaatgagcctacaacgaaagtagttcacttgcaacctgacggcaacagcttt
gatctgatgagaaatttaataacaagaaaaacttag

DBGET integrated database retrieval system