KEGG   Schizosaccharomyces pombe (fission yeast): SPBC30D10.17c
Entry
SPBC30D10.17c     CDS       T00076                                 

Gene name
smi1
Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: SMI1_KNR4
Other DBs
NCBI-GeneID: 2540339
NCBI-ProteinID: NP_596268
PomBase: SPBC30D10.17c
UniProt: O14362
Position
II:3062313..3063827
AA seq 504 aa
MSKNSFSSMANSVTSFFQSLTTPNRHADPSFRPSRREKQSRLPTPLQSVAASAYSGVNAS
QTGLLNDSRANSVTNLPNSSNTSQVGLNNISPAPVGYVPGSKTNELANNSMEMQEISPNG
SASLPPPVSESWRRIDRWAEENYYELYCQLCYGATVADVDSLEYELECTLPRDVRESLYI
HDGQDRGGQPTGILFGVTLLDIEEIEEESELWRRVAQSYAEATLAGKIDQAVASRQASFP
PGAVQCVYAHPGWIPLAKDFVGNNIAIDLAPGPAGQWGQVILFGRDQDTKYVVARSWADF
LAIVAYDMENGKWLVDEDDNSLRLIYGPPREQWSYLDILKYRARKAERRKFKKRDGKRTT
RPIPKSIAKEDVTNSANSTAPSTGTTVLDDGLDNNYEDIPLYGPSKDEELIKKEELEADT
DLGLINTSEINQPANLPDEPTAETSNPVSATTVEAVTTTADNKDEEKNDHVTEDVSQNST
IAEASSLQAQEEEKEIETTSVKQE
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtcgaaaaattcgttttcttcaatggcgaactctgtcacgtcgttttttcaatcgtta
acaactcctaatcgtcatgctgatccctcttttcgtccttctcgtcgtgaaaaacaatcc
cgccttcctacacctcttcaatctgttgctgcttctgcttattcaggtgtcaatgcaagc
caaaccggattgttgaacgatagcagggctaattctgttaccaatttacctaactcctct
aacacctctcaggttggtttgaataatattagtccagctccggttggttatgttcctgga
agtaagaccaatgaacttgctaataattctatggaaatgcaagagattagccccaacggt
tcagcctccttgccgcctccagtctctgagtcctggagacgtattgatcgttgggctgaa
gaaaattattatgagctttattgccagctatgttatggagctaccgttgctgatgtcgac
agtcttgagtatgaactcgagtgcacgcttcctcgagatgtacgcgaaagtttatacatc
catgatggtcaagatagaggtggacaacctaccggtatattatttggcgttactttgctc
gatattgaagaaatcgaagaggaatctgaactatggcgtcgtgttgctcaatcctatgca
gaagctacacttgctggcaaaattgatcaagcggttgcctctcgtcaagcttctttccct
cctggtgcggttcaatgcgtgtatgctcatcccggctggattcctcttgcgaaggatttc
gtgggtaataatattgcgatcgacctagctccgggccctgctggtcaatggggacaagtc
attttgttcggcagagatcaggacactaaatatgttgttgctcgctcttgggcagacttt
ttagcaattgtagcatacgatatggagaatggcaagtggttagttgatgaagatgacaac
tctttacgcttgatttatggtcctcctcgtgaacaatggtcatatctcgatatccttaag
tatagagctcgcaaggcagagcgtaggaaattcaagaagcgtgatggtaagcgaactact
cgtcccattccgaaatccattgccaaggaagacgttacgaacagtgcgaatagtactgca
ccatctacgggtaccactgttcttgatgacggtttagataataattacgaagatattcct
ttatatggtccttctaaggatgaagaactaattaagaaggaagaattagaagcagacaca
gatcttggtttaattaatacatctgagattaatcagcctgcgaatctccccgatgaacca
accgctgagacttctaatcctgtttcagctaccactgttgaagcagtaactacaactgct
gataacaaggatgaagagaaaaatgatcatgtaacagaagacgtgtcccaaaacagcact
attgccgaagctagttctcttcaagctcaagaagaggaaaaagaaatagagactacaagt
gtgaagcaagagtaa

DBGET integrated database retrieval system