KEGG   Schizosaccharomyces pombe (fission yeast): SPBC317.01
Entry
SPBC317.01        CDS       T00076                                 

Gene name
mbx2
Definition
(RefSeq) putative MADS-box transcription factor Pvg4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 2540350
NCBI-ProteinID: NP_596507
PomBase: SPBC317.01
UniProt: Q9HGP0
Position
II:3626639..3627757
AA seq 372 aa
MGRKKISIAPITDDRSRSVTFVKRKQGLYKKAYELAVLADCEVAVTVIDRKGRLHVFCSS
DYQRTLQQLNTLSIYELKNRSHFSSSPVEESSTVSPETTTGSFTPLNNKHLKSQDQPLSD
SQLDTGDSPATSETTVQDYNPQVQSYCRPEPLSSNHVRSCPPFPPTQHHHPHTRPPHHPP
HPHFHNNNYPPPYCFQSPVSPGATVPLQHHSPYPSDNGFPGHRRQTHFAPYYYPQRATSP
SLKQVPTYLGTHVLQQDQSTYDQKVLMPPASYLSSPNQYTLKNVSPGNPACPPFLYEHPN
PQLTPEMFDVKQGSPIPPTAYSGSSCETSQHTIANTPFLAYDRSPSLTNQEAESSFQDVA
SISPHSLSDVKY
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggggcgcaaaaaaatctccattgcacccataaccgacgatcgttcaaggagcgtaact
tttgtcaaacgaaaacaaggtctctacaaaaaggcgtatgaactcgctgtgctagccgat
tgtgaagtcgccgtcacagtcattgatcggaaaggacgtttgcacgtcttttgttcctct
gactatcaacgtactcttcaacaactcaacactctcagcatatatgagttaaaaaaccgt
tctcatttttcgtcatcgcctgtcgaagagtcaagtaccgtgtctccagaaacgacaact
ggttcatttactcctcttaataataagcatttgaagtcacaggaccaacctttatcagac
tcccaactcgacactggtgattctcctgcaacatcggaaacgactgttcaggactataat
cctcaagttcagtcttactgtcgtcccgagcctttatcgtctaatcacgttcgttcttgt
cctccatttcctcccacacaacatcatcatccccatactcgtcctcctcatcatccacct
catcctcattttcataacaataactatccaccgccctattgtttccaatctcctgtgtct
ccgggtgctacagttccattgcaacatcattctccgtaccctagtgataacggctttcct
ggtcatcgtaggcaaacgcacttcgctccttactactatccacaaagagctacgtctcct
tctttgaaacaagttccaacttatctgggtactcatgtactgcaacaagaccagtccacc
tatgatcagaaggtccttatgcctccagcaagttatctttcttcacctaatcaatacacc
ttaaaaaatgtctctcctggtaacccggcttgccctccttttctctatgaacatccaaat
ccacagctaacgcctgagatgtttgatgttaaacaaggctcacctattccgcctactgcg
tattcgggtagcagttgtgagacttctcaacataccattgcgaatactccatttttggca
tatgatcgctctccttccttaacgaatcaagaagctgaatcatccttccaagacgtagct
tccattagtccacattcactcagtgatgtcaaatactaa

DBGET integrated database retrieval system