KEGG   Schizosaccharomyces pombe (fission yeast): SPBC31E1.01cHelp
Entry
SPBC31E1.01c      CDS       T00076                                 

Gene name
atg2
Definition
(RefSeq) autophagy-associated protein Atg2
  KO
K17906  autophagy-related protein 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04136  Autophagy - other
spo04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPBC31E1.01c (atg2)
   04136 Autophagy - other
    SPBC31E1.01c (atg2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC31E1.01c (atg2)
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBC31E1.01c (atg2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC31E1.01c (atg2)
Membrane trafficking [BR:spo04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    SPBC31E1.01c (atg2)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    SPBC31E1.01c (atg2)
Transporters [BR:spo02000]
 Other transporters
  Others
   SPBC31E1.01c (atg2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATG_C ATG2_CAD Chorein_N
Motif
Other DBs
NCBI-GeneID: 3361214
NCBI-ProteinID: NP_001342784
PomBase: SPBC31E1.01c
Position
II:complement(join(234503..234523,234594..239513))
Genome map
AA seq 1646 aa AA seqDB search
MRLPSWLKNSSSWLWTAALSRTVQRRLLAFALRKLIGSILLENVQPEDIDILFSKGVLML
SNLQLNCSFLNAVVSLPMINFTKGTLRRLILRLNVTDIVNLNVELEVNGLSLEIELVPPD
ESLSSTTYEDAPSQLDILDNVVEYMNKTASQDFEDEVINEGLESEIDGSSHNLLDSILQK
CLASTSVLMQDALVYIGTANMSTRLEAKLDFMSFSSVKSNSTSRLLNINGITVSMVRPIS
KSNAGSSSPPRSEESFVSMDSSSSIVEGFENDLSPSQVTLNESSIISSNREEESFYSVHD
SVTQKKTRTSWLIFQCSGEFRLVFSIESSNLLVIESHVPSCVLNINSQVIAFLLYLYGYF
LPAPSTPGFSSNKPPLTMLQLDIHISSVQILTHCKLPESQDFSMHNDVDELLHTIPSNGA
VFEMKINQIQIFNDNNDIDELTMTFSDLDIFMDSVTLVSFGKSLQSPCSLIFKKLERIVS
LFIHIPGGEISLPLGKALLLQESFVEFTNDISNLQNFLSNSDPFKRSIQETFEAPKPFEV
EMNQPSFEIIALFDELQLQILNELSTQSLYKLTLRVSHLQFTRKSTGSLSSVLIFVKKIG
CQSELFNCENSDWTKVSSSTAFHLSNSLFETHDTTGTSNFAVSIQQEKHYYPVFQPAPTE
FSYPEKHFYFAVDNFNVFISKEVVRLFKTLYETIASSLVTPVTPNKLVTSDYKNVLKIRT
RTFSLSLLNDDGSSFALKCIRIKHYMCWAGAQLISLSLRLYNVSAEYLSESLEILPVVSF
IRNLRNDEKYLLNADFSYALKRSSGSNDNTIFVKITDLGYEHYPTCPWISDLLKTYFPQD
PEVPFLAFPDFPFNIKLDLRESIIGLNPRTLEAKLLLYLKSLDVEIDALVASNPLNIRIM
AAETVVYIIDKLNQSVLEGKTSVLKREILNSSLHFPGLSIKDTIEFVVKSLGYVEISQLK
NLTLSLVVNAEEGVFSTLITVDNLDAQVQSCADSTELLIKVLSDLGSTEDEEISDCYLAL
PIEDYAKSLTEVDYNFFENRGIDYKSNPTEQSTVLVSSDNDISSQEIKIVDDYYISSNEH
STHASDLASVSSEEFVIDDGSSSIIDISDELQDESSSRDSLKKGIELIEDYYLSQSTSKL
ESSVEGKNYLLKVKFKDINVNWDLHDGYDWEATRATISSAIEKLCDSSSQNDKISPEAKT
LLFQSIVIKSFSKVGRLNINHVSEPIDSDEFADYLSKSISYHLRLGKSKSKKIGIEIKDL
QGSFTVYADSNEPNAVLNDLDIGLKDLIIYDHLSTSTWNKFFGRDSRSPSSKNRNQHMNA
QIVTVRPLPELNNRELRLEFSVLPCKMYIDQDTLDFLIRFLTFQTPSSSETLNTEPDLPF
FQSICINATHVTIDFKFKSADKVGLRSGKLPDLGSLIVMQGSEVFLRQLQIYGLSGAEEF
LNALLNVWLQDIRNNQLSKVLNGVVPIRTMFTVGRGIKDIFVSPVRGLQGNHSVGSFRHG
IIKFTEKYVNDFLSLNAQGATGTHSLLRQAESYLERGSNASASASRARSYYAEQPETIEQ
GLRQGYSGLKQGLLGAKSTLMGLPRETRSHKSLGGVAQTVGRKVPLIVLQPMIGATEAVS
KTLLGLSNSLQPQRRQDMREKYKRPG
NT seq 4941 nt NT seq  +upstreamnt  +downstreamnt
atgaggttaccctcatggcttaaaaattcttcctcttggctctggacggcggcgttatca
aggactgttcaacgtcgactattagcatttgccttgagaaagcttattggatccattctt
ttagaaaatgtgcagcctgaggatatagacatccttttttcaaaaggggtcctaatgttg
tccaatttacagctaaattgttcctttctgaatgcagtggtgtctcttccaatgattaat
tttactaaaggaacgttgaggagattaattttaagactgaatgttactgatattgtaaat
ttaaacgttgaattagaagtcaatggcttaagtttggaaattgaactagtacctcctgat
gaatccttaagctcaactacatatgaggatgctccatcacagcttgatatattggataat
gttgttgaatatatgaataaaacagcatcgcaagactttgaagatgaggtgatcaacgag
ggattagaatctgaaattgatggctcttcacataatttattggatagtatattgcaaaaa
tgtttggcatctacctctgtccttatgcaagacgctttagtttacatagggactgcaaat
atgtctactaggttggaagcaaaactagattttatgagcttttcgtcggttaaaagtaac
tctacatctcgattactcaatattaatggcataacagtatccatggttcggcccataagc
aagagtaacgcaggatcatcttctcctcctcgatctgaagagtcatttgtatcgatggat
tcctcttctagtatagtagagggctttgagaatgatctatcgccatcacaggtcacacta
aatgaatcatcaataataagctcaaatagagaagaagaatcattttactctgtccacgat
tctgttactcagaaaaaaacaaggactagctggttaatttttcaatgttctggcgaattt
aggcttgttttcagtattgagtcctctaacttattggttattgagtctcacgtcccttca
tgtgttcttaatattaactcacaagtcattgcgtttctgttatatctctacgggtatttt
ttacctgctccttccacccctggattttcttcaaataaaccgcctcttactatgttacaa
cttgatatccacatatcttctgtacaaatccttacccactgtaaactccccgaatctcag
gatttttctatgcataatgatgttgatgaattgctacataccatcccctcaaatggagct
gtttttgaaatgaaaattaatcaaattcaaatctttaatgacaataatgatattgatgaa
ctaacgatgactttctctgatttagatatttttatggattctgttacactggtgtctttt
ggtaaaagtctgcaatcaccatgctcgctgatttttaaaaagcttgaacgaatagtgtcc
ttattcatacacattcctgggggagaaatttctttacctcttggaaaggccttattactt
caagaatcgttcgtggagtttactaatgatatatccaatctgcaaaatttcctgtcaaat
tcagatccatttaaacggtcaattcaagaaacctttgaggcgcccaaaccctttgaggtg
gaaatgaatcaaccgagttttgagattattgcactctttgatgagcttcaacttcaaata
ttgaatgaactttcaactcaatcattatacaaacttactttgagagtatctcacttgcaa
tttacaagaaaatctacagggtctctttcatctgtattgatatttgtaaaaaaaatcgga
tgccagtcagagttattcaattgtgaaaattctgattggaccaaggtgtcatcatctact
gcttttcacctttctaatagtttatttgaaactcatgacactaccgggacttccaatttt
gcagtttctatacagcaggaaaagcattactatccagtatttcagcctgcgccaaccgag
ttttcctatccagaaaagcatttttattttgcagtcgataactttaatgttttcattagc
aaggaggtcgttcgacttttcaaaactttatatgaaactattgcttcctctttggtaact
ccagttacacctaataagttggtgacttcagattacaaaaacgtattaaaaatccgcacc
agaacattctcgttatctttattaaatgatgatggcagctcttttgctctcaaatgcatt
cgaattaagcattacatgtgttgggctggtgcacaattaatttcattgagtttacgactt
tataatgtttctgcggaatacttatctgagtctttagaaattttaccagtcgtttctttt
ataaggaacttaagaaatgatgaaaagtatttattaaatgctgattttagctatgccctt
aaaagatcatcaggatctaatgataataccatatttgtcaaaataactgatcttggatat
gagcactaccctacatgcccttggatttcggatttattaaaaacctactttcctcaggat
cctgaagttccattcttagcatttcctgattttccatttaatattaagttggaccttaga
gagtcaataataggtctgaatcctaggacgcttgaggcgaagttattactatatttgaag
tcacttgatgttgaaattgatgcacttgtcgcttcaaatccattaaacattcgtatcatg
gcagctgaaacggtagtatacattattgacaaattgaaccaaagcgttttggaaggaaag
acttctgtgttaaaacgtgaaattcttaactcttccctccatttccctggactctcgata
aaagatactatcgaatttgttgttaaatctttgggttatgttgaaatatctcagctaaaa
aatttgacattgtcattagttgtcaatgctgaggaaggggttttttctaccttgataact
gttgataacctcgatgcacaagtacaatcttgtgcggatagcaccgagttgttgattaaa
gttttgtctgatttaggatcaactgaagatgaagaaatatcggattgctatttggctctc
cctattgaagactatgcaaaatccttgaccgaagttgactacaacttttttgaaaatcgt
ggcatagattacaagtccaatcctactgaacagagtacggtgctagtatcttctgacaat
gatatatcttcgcaagaaattaaaatcgtagacgattattatatttcttcaaacgaacac
tccactcatgccagtgatttggcatctgtttcgtccgaggaatttgtaatagatgatggt
tcgtcatcaattatcgatatttccgatgaacttcaagatgaatcgagttcccgagactcc
ttaaaaaagggtatagagcttattgaggattattacttaagtcaaagcacttcaaagctt
gaatcttctgtagaaggaaaaaattatctcttaaaagtaaaatttaaagatatcaacgtg
aactgggatttgcatgatggttatgattgggaagctactcgagcaactatcagctcagct
atcgaaaaactatgcgattcttctagtcaaaatgataaaatttctcctgaagcgaaaacc
ttattgtttcaaagcatagtcatcaagtctttttcgaaagtgggaagattaaatatcaat
catgtatctgaaccaatcgattctgatgaatttgctgattatttatcgaaatctatttcg
taccatttacgcttggggaagtcaaaaagcaaaaagattggaatagaaattaaagattta
cagggctcttttactgtatatgctgacagtaatgaacctaacgcagtactgaacgattta
gatattggtctgaaggacttaattatatatgaccatctatcaacctcaacctggaataaa
ttttttggacgagattccagatctccgtcttccaagaatcgtaatcagcacatgaatgct
caaattgttactgtgcgaccgttacctgaactaaataacagagaattgaggttggaattt
agcgttctgccttgtaaaatgtatattgaccaagatactttggattttttaatacgtttt
cttacttttcaaactcctagttcctctgaaacgttaaacaccgaacctgatctaccgttt
tttcaatccatctgcataaatgctactcatgtaactatcgattttaaattcaaatcagct
gataaggtaggattgagaagcggaaagcttcctgatttaggcagcttgattgttatgcaa
ggttcggaggttttcttgcgtcaattacaaatttatggactttctggtgcagaagaattc
cttaatgcccttcttaacgtttggttgcaagatatccgaaacaatcaactctcaaaagtt
ctgaatggtgtagtgccgattcgaacaatgtttactgtaggaagaggcattaaagacatt
tttgtaagtccagttcggggcttgcaaggaaaccattcagtcggtagtttccggcatggt
ataattaaatttactgaaaagtacgtgaacgactttctgtctttaaatgcgcaaggtgct
accggtacgcattctcttcttcgtcaagccgaaagttatttagaaagaggaagcaatgct
tctgcatctgcgtccagagccagaagttattacgctgaacaacctgaaacaatagagcaa
gggttgagacaaggttattctggtttgaaacagggattactcggtgccaaatccactttg
atgggtcttcctcgagagacccgcagccataaatcccttggtggtgttgctcaaacagta
ggtagaaaagtgccattaattgttctacagcccatgattggagccactgaggctgtttct
aaaacgctattaggcttatcgaattcgctgcaaccacagagaagacaggatatgcgagaa
aaatacaaacggcctggttga

DBGET integrated database retrieval system