KEGG   Schizosaccharomyces pombe (fission yeast): SPBC31E1.03
Entry
SPBC31E1.03       CDS       T00076                                 

Gene name
hub1
Definition
(RefSeq) ubiquitin-like protein modifier Hub1
  KO
K13113  ubiquitin-like protein 5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPBC31E1.03 (hub1)
Spliceosome [BR:spo03041]
 Complex B
  Other components
   Complex B specific factors
    SPBC31E1.03 (hub1)
SSDB
Motif
Pfam: ubiquitin Ubiquitin_2 Rad60-SLD YukD
Other DBs
NCBI-GeneID: 2540389
NCBI-ProteinID: NP_595099
PomBase: SPBC31E1.03
UniProt: O94650
Position
II:complement(join(244611..244713,244763..244864,244935..244951))
AA seq 73 aa
MIEVLCNDRLGKKVRVKCMPDDTVGDFKKLVAAQTGTDPRRIVLKKWHSVFKDNITLADY
EIHDGMSLEMYYS
NT seq 222 nt   +upstreamnt  +downstreamnt
atgatcgaagttttatgtaacgatcgtctagggaaaaaagtacgcgtaaaatgtatgcct
gatgacacagttggagattttaaaaaacttgttgcagctcagaccggtacagatccaaga
aggatcgtcttaaaaaaatggcacagcgtctttaaggataacatcacattagccgactat
gaaatacacgatggaatgagcttggagatgtattattcttaa

DBGET integrated database retrieval system