KEGG   Schizosaccharomyces pombe (fission yeast): SPBC31F10.03
Entry
SPBC31F10.03      CDS       T00076                                 

Definition
(RefSeq) putative ChaC-like cation transport regulator
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00480  Glutathione metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SPBC31F10.03
Enzymes [BR:spo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     SPBC31F10.03
SSDB
Motif
Pfam: ChaC
Other DBs
NCBI-GeneID: 2540372
NCBI-ProteinID: NP_596565
PomBase: SPBC31F10.03
UniProt: P87305
Position
II:3756657..3757268
AA seq 203 aa
MKTLSPEGSLWVFGYGSLIWHPPPHYDYSIPCFIKGYVRRFWMRSEDHRGTVNSPGLVLT
LIPYEEWKQFSDWSFTPFDEGCWGMAFRIPAKYATQVREYLDDREVNGYTAHSVPVYAHT
GDEIPVLENCLVYVGTSKSPQFQPSDDLTQMAKIISTRRGKSGDNFVYLFELAKCLRHLS
PESKDIHVFELEAEVRKQMQKTR
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaaaacacttagtccggaagggagtttatgggtgtttggttatggctctttaatttgg
catccgcctcctcactatgactatagtattccatgttttataaaaggttatgttcgcaga
ttctggatgcgtagtgaggatcataggggcactgttaactcacctggtctcgttctcacc
ttgataccttatgaagaatggaagcaattttctgactggtctttcaccccgtttgatgaa
ggatgctggggtatggcatttcgcattcctgcaaaatatgcgacgcaagtgcgagaatac
ttggatgatagagaagtcaatggttataccgcccatagtgttcccgtttatgcccatacc
ggtgatgaaattccggttttggagaattgtctcgtttacgtgggtacttcaaagagtccc
caatttcagccctcagacgacctaactcaaatggctaaaatcatttctacacgaagagga
aagagcggagataactttgtttatctatttgagcttgcaaaatgtttacgccatctgtct
cctgaatcaaaagatattcatgtttttgaattagaagctgaagttaggaagcaaatgcaa
aaaactcgatag

DBGET integrated database retrieval system