KEGG   Schizosaccharomyces pombe (fission yeast): SPBC31F10.07
Entry
SPBC31F10.07      CDS       T00076                                 

Gene name
lsb5
Definition
(RefSeq) putative protein lsb5
  KO
K20524  LAS seventeen-binding protein 5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC31F10.07 (lsb5)
Membrane trafficking [BR:spo04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    SPBC31F10.07 (lsb5)
SSDB
Motif
Pfam: VHS GAT
Other DBs
NCBI-GeneID: 2540327
NCBI-ProteinID: NP_596569
PomBase: SPBC31F10.07
UniProt: P87308
Position
II:3763170..3764084
AA seq 304 aa
MGIFSETVPITAVTTYIDRLTSRDTDDEDLSGIVQLSEAVNLTVTGPREASRTLRKKLKY
STPHEQVRALVILQALIENAGSHFLQNFSDEKLEDRMLQCATNSEYSKPVRKRAIHMIKL
WHNDYSNVRGMESMSSLVSRLPQRQSSASHSEQPTINLKKVGPILERLIASSSMAATNLS
NSLVRINPNTENPAKNKQIMVYYVDCKRAHRSLLRYIQAIQDEMWLANLLKANDEIVTAI
DAFKEKCSENSDYSSDSGSYSSSYSRHLDDRASYISRSSSGGSNAQRSEDLDVNNPFGDH
NRLE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgggaattttcagtgaaacagttccaattactgctgtcaccacttatatcgatcgttta
acctctagagataccgacgatgaggatttgtctggtatcgttcaattatctgaagccgtt
aatttaactgttactggtccgcgagaggcttctcgtacccttcgtaagaagttaaagtac
agtacacctcatgaacaagttcgggcacttgttattctccaggctttaattgaaaatgct
ggctctcattttttacaaaatttctcagacgaaaaattggaagaccgaatgttgcaatgt
gcaacaaattctgaatattctaaacccgttcgtaagcgtgctatccatatgatcaaactt
tggcacaatgactattctaatgttcgtggaatggaaagcatgagtagtttagtatctcga
cttcctcaacgacaatcatctgcttcgcattctgaacaacccactatcaatcttaaaaag
gttggtccaattttagaaagattgatagcctcttccagcatggctgctaccaatctttct
aatagccttgtccgaatcaatcctaacacagaaaatccggccaaaaacaagcaaatcatg
gtttattatgtggattgtaaacgtgctcatcgctccttgttgcgctacatacaagctatt
caagacgagatgtggttagccaatctcttgaaggcaaacgatgaaattgtgacagccatt
gatgcattcaaggaaaaatgctccgaaaactcagattatagttcagatagtggatcctat
agttcttcatattctcgtcaccttgatgatcgggcttcttacatatctcgctcgagtagc
ggaggttctaatgctcagagatcagaagatttggatgtaaacaatccttttggcgatcat
aatcgtttggaataa

DBGET integrated database retrieval system