KEGG   Schizosaccharomyces pombe (fission yeast): SPBC31F10.13c
Entry
SPBC31F10.13c     CDS       T00076                                 

Gene name
hip1
Definition
(RefSeq) histone chaperone Hip1
  KO
K11293  protein HIRA/HIR1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC31F10.13c (hip1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     SPBC31F10.13c (hip1)
SSDB
Motif
Pfam: Hira WD40 HIRA_B PD40 Ge1_WD40 SoxZ
Other DBs
NCBI-GeneID: 2540219
NCBI-ProteinID: NP_596575
PomBase: SPBC31F10.13c
UniProt: P87314
Position
II:complement(join(3774357..3776749,3776790..3776881,3776923..3777121,3777178..3777255,3777314..3777350))
AA seq 932 aa
MKIKKIPWLGHFDDRGHRLSIFSIHIHPDGSRIATGGLDGTIRIWSTEAINRENENENEN
EDLPKQLCCMSTHTGTVTSVRFSPNGQYLASGSDDRVVIIWHKEEAIPGLGSTFGSGEKH
TENWRSYRRLLGHDNDIQDLCWSYDSQLVVSVGLDSSIIVWNGTTFERLKRIEAHQSHVK
GITFDPAGKYFATESDDRTIKVWRVSDFSIEKTITGPFNNSPLSTYFRRPSWSPDGKHIA
APNAMNGPVSCVSIIERGTWTSEINLIGHEGPVEVTAFNPKLFRDKNDKLVCILACGGQD
RSLSIWSSALPRPLLSCQNVFQKSIGDVCWSPDGLSLFLCSYDGNVLVCTFEKEEFGDMV
SDEEISKALAKYGHGRHGIVLPESAKQLELEETAYAILKKPSSLSTTDPTLVPQSSSTPK
SAQKTPQKLPAFLPNRLTAETVDTNKLTASKEQIASPKRPGPSDNGNEIPTKFVQKVTIT
KEGKKRVAPQLLTTLSATPSTSRLASTQLQHTGSSQLPPQQFSQPINSLPKGGVPILIVG
NKTKVNHENDESDQALQEEKIEEGLLKNYYSSLIDSSTSISNINFEAPRYKTNIVHSLNN
EQKYVLEVKNGTSEKNPTRIVALENGNTKWMDYLPRPVILVTGSIHFWSIACDDGSLHLY
SLTGSRLLPPIMIESKASFLHCNNAYLLCISSSGMVYAWNVVNKTALFTANSLAPILSRV
SNNVTIENNSTDIPHVVIASISKEGVPSVTLSTGETYVYSSTMLCWQRITEPWWAIGSRE
WDSSGLLQSNTQTESQPLKIYEHRTNNVLMDSGRGKLLQKMVADAITEEGYDDFETIVTI
NHLENKIASARLLKLDDEFLVTSEVYVRLLMHHGLWQKLEEFLGELRTQTKCSIKLSGRE
VVAKMLVVLRQAVQTDNEFDRANKLIEKYAST
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgaaaattaaaaaaattccatggttaggacactttgacgatcgagggcatcggctatct
atattttctattcacatacatccagatggatcacggatagcaactggaggactggatggt
acaattcgaatttggtctactgaagctatcaaccgtgaaaatgagaacgaaaatgaaaat
gaagatcttcctaaacagctgtgttgtatgagtactcatactggtacagttacttcagta
cgttttagccctaatggtcaataccttgcttcaggtagtgatgatcgagtagttattata
tggcacaaggaggaagcaattcctggtttaggttctacgtttggatccggtgaaaaacac
actgagaattggcgtagttaccgacgtttactgggccacgataatgatatccaggattta
tgttggagttatgatagccaacttgtagtgagtgtcggattagatagttcgattattgtt
tggaacggtactacttttgaacgactaaagcgaattgaagctcatcaaagtcacgtgaaa
ggtataacttttgaccccgcgggtaagtactttgccactgaaagcgatgatagaactata
aaggtctggagagtaagtgacttttcaattgagaagaccattacaggtccctttaacaat
tcacctttatcaacctattttcgaaggccgtcttggtcaccggatggaaaacatattgct
gctccaaatgcgatgaatggtccagtgtcttgtgtttcgataatagagcgtggaacatgg
accagtgaaattaatcttatcggacatgaaggacctgttgaggttaccgcttttaatcct
aagttattcagagataaaaatgataaactggtttgtatattggcttgtggtggtcaagat
cgatctttaagtatctggtcaagcgctttacctcgacctcttttgtcttgtcaaaatgtt
ttccaaaaaagtattggtgatgtttgttggtcaccagacggattgagtttgtttttatgc
tcgtacgatggaaatgtcttagtatgtacttttgaaaaagaagagtttggtgacatggtt
agcgatgaagagatatcaaaagcgttggctaaatatggtcatggtcgtcacggtatagtg
cttcctgaatctgcaaagcaactcgagcttgaggaaaccgcctatgctatcttaaaaaaa
ccgtcttctctttctacaactgacccaacactagtcccccaaagctctagcactccaaaa
agtgctcagaagacacctcaaaagttacccgcttttttaccaaatagattgacggctgaa
actgttgacacaaacaagttaacagcttctaaagaacaaatcgcatcacctaaaagacct
ggtccgagtgataatggtaacgaaataccgactaaatttgttcagaaagttactatcacg
aaagaaggtaaaaagagagttgctccacagctattgaccactcttagtgcaactccaagc
acttctcggctagcttctactcagttacagcatactggatcatcccaacttcctcctcaa
cagttttcacaacctatcaattcattacctaaaggtggggttcctatactaatcgttggt
aacaaaacaaaagtcaaccatgaaaacgatgaaagtgatcaggctttacaggaagagaag
atagaagaaggtttattaaagaattactattcttctctaattgacagtagtacttcgata
tctaacataaattttgaagctcctcgatataaaactaatatagttcattctcttaataat
gagcaaaaatacgttttggaggtgaaaaatggaacaagtgaaaaaaatccaactagaata
gttgccttggaaaatggaaacactaaatggatggattaccttccaagaccggttatactg
gttactgggagtattcatttttggtcaattgcgtgcgatgatggatctctacatttgtat
tcattgacaggttcaagactgctaccgccaataatgattgaatctaaggcttcatttttg
cattgcaataacgcgtatttgctttgcatttcttcaagcggaatggtatatgcttggaat
gtggtgaacaagactgctctatttactgccaattcattagctccaatcctaagtagagtt
agcaacaatgttaccattgaaaacaactcgactgacattccacacgtagttattgccagc
atcagcaaggaaggggtccccagtgttacgctttctaccggcgaaacgtacgtttattcg
tctacaatgctttgttggcaacgaattactgaaccgtggtgggctataggaagtcgggag
tgggattcaagtggattactgcaaagcaatactcaaaccgaaagtcagccgctcaaaata
tatgaacaccgaactaataatgttttaatggattctggaagaggaaaactattacaaaaa
atggtagctgatgcaatcactgaagaaggttatgatgattttgagaccatagttactatt
aatcatttagaaaacaaaatcgcttctgctcgattacttaagttggatgatgagttttta
gtaacaagcgaagtttatgtcagactattaatgcatcatggtctttggcaaaaattggag
gaatttttaggagagctacgaactcaaacaaaatgttcaattaaattatcaggaagagaa
gttgttgcaaaaatgttagtggttttacgacaagcagtacaaactgataatgaatttgat
cgtgcaaacaaattaatagaaaaatacgcatcaacctga

DBGET integrated database retrieval system