KEGG   Schizosaccharomyces pombe (fission yeast): SPBC31F10.14c
Entry
SPBC31F10.14c     CDS       T00076                                 

Gene name
hip3
Definition
(RefSeq) HIRA-interacting protein Hip3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_1 TPR_14 TPR_7
Other DBs
NCBI-GeneID: 2540227
NCBI-ProteinID: NP_596576
PomBase: SPBC31F10.14c
UniProt: P87315
Position
II:complement(3777778..3782670)
AA seq 1630 aa
MATFTPLNAASEDLDKEKRTLEIRIEEAVQIYQNALSAQKQGDDNAATKYYDELLNVRIL
RELPFTVNSNYKKNNALLLLHYLTRKNHGLFLLSKLQSLLSLDPSTDPIPVYRDALLDFA
IALACDYNDIELWSFVAELAEKLEMPRIQRFALESSFYTGYEPFDAERVFTNIDDLNPGK
LISLQNLYNLLKKLGGIAEPLPQLDLSISSLYTLPSFFPQLPTPSFHRRSINLCPKIKKL
QLSHDTLHGFLDLVLYALQINEKKTPTRGFPSTLIIHVHSLNLSTAESHDLESTDSELWS
EISDAGPDTNTINTAAKLSEPVYAKDIVPPPSDNLPKPQLLKRPIDDSDVRISKRSRGRD
LRTPSESNLFSLIASITSDINEQIQKRFPDATSPFSGESMFREYSSIFEDYHQLLVNFPS
EGSIPDLDVSTDSAANGAFSKMILIDLAMHSANRLEHMQVPDGYLLQLLSEVNSLNMVPA
ELATFFVESMLRPRKLEPPFYLQQCWGKIFKKKFTTICERIESTLHELVKASLQTPEVFN
ISQSLFELFLDDYFLALKFSSNDQKDDNVSEIPTESLEYKKLRCLRWKSLTEQVVELQPS
CKSSSQRHLIIRNSWARNLLLRLTGCSSEAIVENFKQLRCLLQENSDSLELLNSQCMADL
SVQVVDFELSKLQTVEFFNTLFMNTKNLDFNAVIKNLEPVLSPENKFAEDPQAKFISQFL
EKTSTEFQIHLWYLLYQAYSSAHRPYNSLLCAFQSLKIILIRLCSSSFSIQDAGRRQAEL
LGMLNFSSNLFRIIWQKLHEQPDILSPCNEMTVIDCIRIILIYLRTFAIYVGIDEDISDQ
RIPKPSNPEFDSYAQTVKDSLMSGWCIFYTLFAHLLHYDFIKADAQKLLPQILTAIHSQY
SFRGYCSSSNQSFLELSQTECQRLDAWENENEILQCVCCRFNLIIGSEYYVPQSHQSDSV
NLTSNDAIKIIPFILGFAVKRSHGWVMPRSDQKNALEIICKVIRFPGENNADVYFNKCAI
KEFLERDISPQLTKMLLKSNDILGLREIGSKVVDDRVRGLYYAQSQVLFGYYRSRLKGSR
CINDLLVIIKYFLLDLYLNPRRQDSWYTCSSVFSSLADEELGWSAEQICLADDVINEYRR
KAILCNLMALSLPFTQDKLFKANVYFDFAMNLYASARPPLEMAAFLPSETRVFSGASGLY
NLSMKPIEVSKVIALAADYFGMSAELSNDWRALYMLGKACRKCGDMENALVHFEAAAALA
PTKSGSGSQQALLIEPHYALLSNLSKAAIEGSVEIVQILSYLRRIRHPPKDSGSLLEVKN
EDVNIYKRNALLFILKALAEMRILDKQSWHHRPTYRIAKIMEHLGNVQQAKEEMETLFSY
KTSGKSLLNIWRTPNERPGRHFYYGATYSRYLLSLFYKTNDKVNFLQFLKRFRRSSSTIY
EHRQIWLDIMIKYLEDLRLQHSVKETQINDLPLVEFKYVYKEISLLDEQKLSLLHQVYEI
RKLNNGLYPTIKVDDFLIDCFMSLYNEVKSSISPLDANIPNSPSTITAKPLNDEKAINNE
NSVKQKTVITRKDVVSKVLALFRPHRETYYRETQNKILQKLASTSSSLVRSFTEDSSQAG
ESPGIHEEIQ
NT seq 4893 nt   +upstreamnt  +downstreamnt
atggcaacgtttactcctctaaatgcggccagtgaagatctggataaggaaaaacgcact
ttagaaatccgaattgaagaagctgttcaaatatatcaaaatgcactttcagcccagaag
cagggagatgacaatgctgctacaaagtattacgatgagctattgaatgttcgaattctt
cgcgaactcccttttaccgttaattctaattataaaaaaaataatgctttattgctacta
cattacctcactagaaaaaatcatggtttgtttttgctgtcaaagctacaatctttatta
tccttagatccttcaaccgatcccatccctgtgtatcgggacgccctgctcgattttgct
attgcattggcttgcgattacaatgacatagaactttggtcttttgttgccgagttagct
gaaaaattggaaatgccaagaattcaaagatttgctttagagtcatcattttataccggc
tacgaaccctttgacgcggagagagtatttacgaatattgatgatttaaatcctgggaag
cttatctctctacaaaacctatacaatttgttaaaaaagttaggcggtatagcagaaccc
ttaccgcaattggatttgtcgattagttctctttatactttgccttctttttttcctcaa
ttacccactccttcatttcatcgaaggtccataaacttatgcccgaaaataaaaaaactt
caactatctcatgacactcttcatggttttttagatcttgttctatatgcattacagata
aatgaaaaaaaaaccccgactcgtggttttccttcgacattaattattcatgttcattcc
ctgaatttgagcaccgcagaatcgcatgatttggaatccactgattcagaattatggtct
gaaatttcagatgcagggcccgatactaatactattaatacagctgcaaaattgtctgaa
cctgtttatgccaaggacattgttccacctccttcggataatttgcctaaaccccaactc
cttaagaggccgatagatgattccgatgtacgcattagtaaaagatctcgtggtagagac
ttacgaacgccttcagagtcgaacttgttttctttgattgcaagcataacttcggatatt
aatgagcaaatccaaaaaagatttcctgacgcaacttccccgttttcaggtgaatctatg
tttcgagaatatagttccatatttgaagactatcatcaattactagttaattttcctagc
gaaggcagtattccggacctagatgtttcgaccgactcagcagctaacggagctttctcc
aaaatgattcttattgatttagctatgcatagtgctaatagacttgagcatatgcaggtc
ccggatggttatcttcttcaattattaagtgaagtaaatagtctcaatatggttcccgct
gagcttgctacattctttgttgagagtatgttaaggcctcgaaaattagagcctccattc
tatttgcagcaatgttgggggaaaatatttaaaaagaaatttactacaatttgtgagaga
attgaaagcactcttcacgaactggtgaaggcaagcttacaaacccctgaagtttttaat
atttcacaatcgctttttgaactgtttttagacgattactttttagcgctcaagtttagc
tccaatgatcaaaaagacgataatgtttctgaaataccaactgagtcattggaatataaa
aaattacgttgcttacgttggaaatctcttactgaacaagtagtcgaattgcagccgtct
tgtaaaagttctagccaaagacatttgataattagaaactcatgggctcgaaacttattg
ttacggttaactggttgttctagtgaggctatagttgaaaatttcaaacagttgcgttgt
cttttgcaagaaaacagtgattctcttgaacttttaaacagtcaatgcatggcagatttg
agcgttcaggttgtcgattttgaactttccaaattacaaaccgttgagttttttaatact
ttatttatgaataccaaaaacttggactttaatgccgttataaaaaatttggaacccgtc
ctttctcctgaaaacaaatttgcagaagatcctcaagcaaaatttatttctcaatttttg
gaaaagacttctactgaatttcaaatacacttatggtatttactgtatcaggcttatagc
tcagcacatagaccttataattcgttgttgtgtgcctttcaatcgctaaaaattatttta
attaggctttgttcttcgtcattcagtattcaagatgccggtcgccgtcaggctgaacta
ctcggcatgcttaatttttcttcaaatttattcaggattatttggcaaaaattacatgag
caacctgatatattgtctccctgtaacgagatgactgtcattgattgcattagaattatc
cttatatacttgcgcacttttgctatttatgttggaatagatgaggacatttcggatcaa
aggattccaaaaccttcaaaccctgagtttgattcttatgctcaaacggtaaaagattct
ttgatgagtggttggtgcatattttacactctgtttgcgcatttacttcattacgatttt
attaaagctgatgctcaaaagttattacctcaaatccttaccgcaatacatagccaatat
tcctttagaggttattgttcgagctctaatcaatcatttttagaactctctcaaactgaa
tgccaacgattagatgcttgggaaaacgaaaatgaaattttacaatgcgtttgttgtcgc
tttaacctaattattggcagcgagtactatgttccacaatctcatcagtcagattctgtt
aatttgacttcaaatgatgccataaagataatacctttcatactcggctttgctgtcaaa
cggtcgcatggctgggtaatgcctcgttctgatcaaaaaaacgcattagaaataatttgt
aaggtaattaggtttcctggtgaaaataatgctgacgtttatttcaacaaatgtgcaatt
aaagaatttttggaaagagatatatctccacaacttaccaaaatgttactaaagtccaat
gacatccttggtttacgcgaaattggtagcaaggttgtggatgatcgtgttagggggctc
tactatgctcaatctcaagtactgtttggatattatcgctctagactgaaaggtagtaga
tgcattaacgatttacttgtgatcatcaagtattttcttcttgacttgtaccttaatcca
cgtcgacaagattcatggtatacttgttcctccgtattttcttcattagcagatgaagag
cttggctggagtgcagagcaaatctgcctcgcagacgatgtcatcaacgagtataggaga
aaagccatcctttgtaacttaatggccttatcgttgccattcactcaggacaaattattt
aaggcaaacgtctattttgattttgctatgaacctttatgcatccgctcgacctccttta
gagatggcggcttttcttcccagtgaaacccgtgtttttagtggggcttcgggtctttat
aatttatcaatgaagccaattgaagtatcaaaagttatagctttggctgctgactatttt
ggcatgtctgctgaattaagtaatgattggagagctttgtacatgctaggcaaagcatgc
cgtaaatgtggtgatatggagaatgctttggtccattttgaggctgctgctgcgttggct
cctactaaatcaggtagtggttcccagcaagcattgcttattgagccacattatgcctta
ctttccaatttgagcaaggctgctatagaaggttcagtggaaatcgttcaaattctttca
tatttacgacgtatccgacatcctcctaaagattcaggaagccttttggaagtcaaaaac
gaagacgtaaacatttacaaaaggaatgctttactatttatactaaaggcgttagcagag
atgcgtattttggataaacaatcttggcaccatcgaccaacttatcgcattgctaaaatc
atggagcatttaggtaatgttcaacaagcaaaggaagaaatggaaactttattctcatac
aaaactagcgggaaatcgctattgaacatttggaggactcctaatgaaagacctggacgg
catttttattacggtgctacctattcaagatatctactctcccttttttacaaaaccaac
gacaaggtaaactttttgcagtttttaaaaagatttcgtcgttcatcctccactatttat
gaacaccgtcaaatttggctggacataatgatcaagtaccttgaagacttgagacttcag
cactccgtaaaagagactcagattaatgatttaccacttgtggaatttaaatatgtctac
aaagaaataagtttattagatgaacaaaagttgagccttcttcatcaagtatatgaaatc
aggaaactgaacaatggcctatatccaacaattaaggtcgatgattttcttattgactgt
ttcatgagcctttataacgaagtgaagtcttcgatctcccctttagatgccaatattccg
aactcacccagtacgatcacggccaaacctctgaatgacgagaaggctattaataatgaa
aattctgtaaaacaaaaaactgttattacaaggaaggacgtggtttctaaagtattagca
ctgtttagacctcatagagaaacttactatcgtgaaacccagaacaaaatattgcaaaag
ttggcttccacttcatcctcattggtaagatcgtttactgaagattcctcacaggcaggt
gaaagtccaggtatacatgaagaaattcaatga

DBGET integrated database retrieval system