KEGG   Schizosaccharomyces pombe (fission yeast): SPBC32F12.05c
Entry
SPBC32F12.05c     CDS       T00076                                 

Gene name
cwf12
Definition
(RefSeq) protein Cwf12
  KO
K12870  pre-mRNA-splicing factor ISY1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPBC32F12.05c (cwf12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPBC32F12.05c (cwf12)
Spliceosome [BR:spo03041]
 Complex B
  Other components
   Prp19-related factors
    SPBC32F12.05c (cwf12)
 Complex C
    SPBC32F12.05c (cwf12)
SSDB
Motif
Pfam: Isy1
Other DBs
NCBI-GeneID: 2540230
NCBI-ProteinID: NP_596148
PomBase: SPBC32F12.05c
UniProt: O74370
Position
II:complement(join(2793222..2793727,2793819..2793951,2794013..2794027))
AA seq 217 aa
MSSAKYVVGSKPTEKRPKDIKSIKSVPICEKHRASVVKDISRKISRIQSATLPEYQIRDL
NDAINRLMREKHEWEVQIRDLGGINYLYNKAKLFEDEGEQISDIDDYRYYGRARELPGVK
ELFEADMSFIPERQRKQEMQKRRLDAWYFGYIPPAQESLLEDFEAKIEEQQHKHLENLGD
EVEQDWKPLVIEQIPTRDDVEAILLERRKNALLSRIS
NT seq 654 nt   +upstreamnt  +downstreamnt
atgtcatcagcgaaatatgtagtgggcagcaaaccaacggaaaagagacccaaggatata
aaaagcattaagtctgtgccgatatgtgaaaaacatagggctagtgtagtaaaagatatc
tctcgcaagatctctcgaattcaaagtgcaacgttgcctgaatatcaaattcgagatttg
aacgatgcaattaatcgattgatgcgtgaaaaacacgaatgggaggtacaaattcgtgat
ctgggtgggattaattatctgtataataaagcaaagctatttgaggatgaaggagaacaa
atcagtgatatagacgattatcgttattacggaagagctcgagagttacctggcgttaag
gaactttttgaagctgatatgagttttataccggaaagacagcgcaaacaggagatgcag
aaaagaaggttagacgcctggtactttggttacataccgccagcacaagagagtctatta
gaagattttgaggcaaagattgaagaacaacaacataaacatcttgagaaccttggtgat
gaagttgaacaagattggaaacctcttgtcattgagcaaataccaactagagacgatgtt
gaagccattcttttagaaaggcgtaaaaatgctttgctgagcagaatttcatag

DBGET integrated database retrieval system