KEGG   Schizosaccharomyces pombe (fission yeast): SPBC32F12.11
Entry
SPBC32F12.11      CDS       T00076                                 
Symbol
tdh1
Name
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase Tdh1
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00010  Glycolysis / Gluconeogenesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01200  Carbon metabolism
spo01230  Biosynthesis of amino acids
Module
spo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPBC32F12.11 (tdh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC32F12.11 (tdh1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC32F12.11 (tdh1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     SPBC32F12.11 (tdh1)
Membrane trafficking [BR:spo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPBC32F12.11 (tdh1)
Exosome [BR:spo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPBC32F12.11 (tdh1)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N ADH_zinc_N 2-Hacid_dh_C LptD_N
Other DBs
NCBI-GeneID: 2540547
NCBI-ProteinID: NP_596154
PomBase: SPBC32F12.11
Ensembl: SPBC32F12.11
UniProt: P78958
Position
II:2807534..2809051
AA seq 336 aa
MAIPKVGINGFGRIGRIVLRNALVAKTIQVVAINDPFIDLEYMAYMFKYDSTHGRFDGSV
EIKDGKLVIDGNAIDVHNERDPADIKWSTSGADYVIESTGVFTTQETASAHLKGGAKRVI
ISAPSKDAPMYVVGVNEEKFNPSEKVISNASCTTNCLAPLAKVINDTFGIEEGLMTTVHA
TTATQKTVDGPSKKDWRGGRGASANIIPSSTGAAKAVGKVIPALNGKLTGMAFRVPTPDV
SVVDLTVKLAKPTNYEDIKAAIKAASEGPMKGVLGYTEDAVVSTDFCGDNHSSIFDASAG
IQLSPQFVKLVSWYDNEWGYSRRVVDLVAYTAAKDN
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggcaattcctaaggttggtattaacggtttcggtcgtattggacgtattgtcctccgt
aacgctttggtcgctaagaccatccaagtcgttgctatcaacgatccttttatcgatctt
gaatacatggcctacatgttcaagtacgactctacccacggtcgcttcgatggctccgtc
gagatcaaggatggtaagctcgtcattgatggcaatgccatcgatgtccacaacgagcgt
gaccccgccgacatcaagtggtctacctctggtgctgactacgttatcgagtccaccggt
gtcttcaccactcaagagactgcctctgctcacttgaagggtggtgccaagcgtgtcatc
atctctgctccttccaaggacgcccccatgtacgttgtcggtgtcaacgaggagaagttc
aacccctctgagaaggttatctccaacgcttcttgcaccaccaactgtttggctcccctt
gccaaggtcatcaacgacaccttcggtatcgaggagggtctcatgaccactgtccacgct
accactgccacccaaaagaccgttgacggtccctccaagaaggactggcgtggtggtcgt
ggcgccagcgccaacatcatcccctcctccactggtgccgccaaggccgtcggtaaggtt
attcccgctcttaacggtaagcttaccggtatggctttccgtgtccctacccccgatgtt
tccgttgttgacttgaccgtcaagttggccaagcctaccaactacgaggacatcaaggcc
gccatcaaggctgcctctgagggccccatgaagggtgtgttgggttacaccgaggacgct
gttgtctccactgacttctgcggtgacaaccactcctccatcttcgatgcctctgccggt
atccaactttctcctcaattcgtcaagctcgtctcttggtacgataacgaatggggttac
tcccgccgtgtcgttgacttggttgcctacactgccgccaaggacaactaa

DBGET integrated database retrieval system