KEGG   Schizosaccharomyces pombe (fission yeast): SPBC32F12.15
Entry
SPBC32F12.15      CDS       T00076                                 
Symbol
tfb5
Name
(RefSeq) putative transcription factor TFIIH complex subunit Tfb5
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPBC32F12.15 (tfb5)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC32F12.15 (tfb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBC32F12.15 (tfb5)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC32F12.15 (tfb5)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPBC32F12.15 (tfb5)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPBC32F12.15 (tfb5)
SSDB
Motif
Pfam: Tfb5
Other DBs
NCBI-GeneID: 2540257
NCBI-ProteinID: NP_596155
PomBase: SPBC32F12.15
Ensembl: SPBC32F12.15
UniProt: Q9HDW3
Position
II:2809816..2810539
AA seq 68 aa
MPRAQKGLLLVECDPTVKQLILNMDEQSPGIVIEEIDEERLLVNESRLEQVKAELERRLE
ENTYQVEE
NT seq 207 nt   +upstreamnt  +downstreamnt
atgccacgcgcacaaaaaggcttactcttggttgaatgtgacccaaccgttaagcaattg
attttgaacatggacgaacagtctcctggtatcgttatcgaagagatcgatgaagaacga
ttgttagtaaatgaaagtcgactagaacaggtgaaagcagagttagaacgacgccttgag
gaaaatacatatcaagttgaagagtaa

DBGET integrated database retrieval system