KEGG   Schizosaccharomyces pombe (fission yeast): SPBC32H8.01c
Entry
SPBC32H8.01c      CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Vfa1 Lin-8 SLC12 TERB2
Other DBs
NCBI-GeneID: 2540089
NCBI-ProteinID: NP_595607
PomBase: SPBC32H8.01c
UniProt: Q9C0V9
Position
II:complement(join(1450371..1450794,1450887..1450936,1451015..1451104))
AA seq 187 aa
MLKKMPMSNKFENFYTLRQVSEVDKKPCFICYKPTKWVLITKTKLDFFYVCYNHLQDRGF
ATPISVIKSVTNKIDTNKLEAKDESKNVEKDATGNPQESKQEPNLEVQQTEKEKDVDSAS
AENESINSSSSSSKECSTQTQSKHYNLHRDIFQMRIRYHANRAAAEKTARLLQSGQGLPS
PPSKPLP
NT seq 564 nt   +upstreamnt  +downstreamnt
atgttgaagaaaatgccgatgtccaataaatttgaaaatttctatacattgagacaagtt
tcagaagtagataaaaaaccatgctttatttgttacaagcctacaaaatgggtattaata
acaaaaactaaattagattttttttatgtttgctacaatcatttgcaagatcgaggtttt
gctacaccaatttccgtgattaaatcagtgactaacaaaatcgacaccaacaaactagaa
gctaaggatgagtcaaaaaacgtagagaaggatgcgaccggtaatccacaagaatcaaaa
caggaaccaaatttagaagtgcagcagacagagaaggagaaagatgtagattcggcgtct
gccgagaatgaatctatcaactcctcctcctcatcttctaaagaatgttcaacacagacc
caatccaaacactataatcttcatcgagatattttccaaatgcgaattcgatatcatgct
aatagagcagctgccgagaaaacagcaagacttctgcaatctgggcaaggactcccttca
ccaccatccaaaccattgccttag

DBGET integrated database retrieval system