KEGG   Schizosaccharomyces pombe (fission yeast): SPBC32H8.13c
Entry
SPBC32H8.13c      CDS       T00076                                 

Gene name
mok12
Definition
(RefSeq) alpha-1,3-glucan synthase Mok12
  KO
K00749  alpha-1,3-glucan synthase [EC:2.4.1.183]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spo01003]
    SPBC32H8.13c (mok12)
Enzymes [BR:spo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.183  alpha-1,3-glucan synthase
     SPBC32H8.13c (mok12)
Glycosyltransferases [BR:spo01003]
 Polysaccharide
  Structural polysaccharide
   SPBC32H8.13c (mok12)
SSDB
Motif
Pfam: Alpha-amylase Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 TnpW Glyco_transf_4
Other DBs
NCBI-GeneID: 2540243
NCBI-ProteinID: NP_595619
PomBase: SPBC32H8.13c
UniProt: Q9UUL4
Position
II:complement(1478104..1485162)
AA seq 2352 aa
MLFFSIPTILLIFFLFIQIITAAFLTDENEPWNLNRNWTAQKILDYSAEWNSHEYFPSPS
NWRALPFYTIILDKWTNGVPENDVAEDTVFESDPYEVTFRAGGDIVGLVTPRSLDYLESM
GIKAVYIAGTPFQNLPWYPDGYSPLDFTLLDKHTGTLNQWHEAIMKLHERGFYVVVDFTI
STLSELSYFVNSSMSFANTSAPFSTKGYKMKYKHPEYHYTDFQLSNGSSYSCNAPTFWDV
TGLPINNTEDLNSISEVMCLSGDFDHYGDVEAFGNHPPWWRQLSNFASVQDRLRDWDPIV
AKKLKHLGCLAVKMLDIDGIRVDKATQITADFLGDWSAYIRQCAREIGKENFFIPGEVTS
GADFGSIYVGRGRQADQRPNNREIALQTGYNESKYFLRKESDSALDSVSFHYSVYRTLTL
LLGLQGELFAAFDLNRHDFAAMWNQMLIQDDMINANTKKFDPRHLYGLTNQDIFRWPSIK
DGRFKQLLGLFVVHLLMPGIPLIYYGEEQNLKLLDNQAANYIFGRQPITSSIGWQKHGCY
QIGTTQYTDLDFGPASEACRDDWNSLDHLDPTSPTKHYIARMNEIRSYFPQVRDGWDLKL
IGKWTHEGTFPGNELYGESNPTTWGLWSMIRGPLAPYQKFSDQNDYIWLIFTNENTTKTY
DMDCMRQVDNKFPPYPALLGPYSSGSTVKNLLYPYEEIDLSTSTIDSPDIGNIGCIPHLT
IDAYGSKIFVKKEDWIRPSLYLTKFLPGHDSRIYSATEVTSFKISLGFSEEVDCKDLFKR
IGFNSRTLNSSFAPKILEDSISCGYLDQPAPQEYTNAPVTKWFFNATLDSVPNGMHELLL
NEVKSTSNQTMQSKIARLIFRVGNEENPLVYPNNATFSPSLLYKASNGDLYVNHTGAGAD
KYRFSLNYGGTYSKWKTVSTPSEKLRKPTWNGTNLQKWDGDHLIVQYWSSIALSTAHVQH
GDTLNYSRQFPNLFVQGAFNRFGYDGSMPSKMSYNLENRTWSYDLISTWPAELVLNVWGM
NPDNNADQGWVYGDLDNDTIIDRVPPGSSRISNFIRFLDPPPKPYLSYKMYLNDFTRQLH
YIPKGSWTVQIVAIVLLILLPPLFGIFSVALYSGAFSRVTIFNGSHNRGIKVAKQKIKSI
MSRIFPFSVHLPLDNSSELLKQLPESEKRLNVLVATLEYDVPDLGIRVKIGGLGVMAQLM
GQHMEFQDMVWVVPIISGVEYPFDKLCTEPKIAVKIGDDEFVVNCYSYKSGNITYVFLQS
EVFYKQSSKEPYPLKMDDLASAIFYSVWNQCIAEVWKRFPLDIYHVNDYHGALAPLYLLP
EVIPVAVSLHNAEFQGLWPLRTSAELECVCSIFNIEKDICTKYVQFGHVFNLLHSIISYV
RKHQGGYGVVAVSDKYSKQTLSRYPIFWSLVHISGLPNPDPSDLKLLNHLTDDPVDVDFV
LEAKRKLLKKQTQEWANLDVDPSAQLLVFVGRWSHQKGIDLIADLAPKLLTEHNVQLITI
GPVIDLHGQFAAEKLEQIAKRFPTRVLCKPVFTAVPPFLFAGTDFALIPSRDEPFGLVAV
EFGRKGVLCIGSRTGGLGHMPGWWFQMASPNTGHLLTQFENAITKALHSNGELRARLRVE
ALRQRFPVCIWKQKSENLLKSCIYVHEMETLKHASPTFKAYQFVVRICHYLTSKVKSINK
DQVFNAFSPDVSERPPLFEVASCSNETDSVEKLTPELSVSPESDMHFKDGNSSKLEIVES
KEIYASDSDISNSTSEDINKDECVSKDIEVDNFALNLQSQSYEGDSNDFGIREVPLSDAN
QSSQADSTSIDRYGPYSSQKVNFSKYKDFVESRPTFFQSSVTFTDADGSTRKTFSKRLEN
LTTSNTLKSLSVDHFIRKHERKYFNGLRKQEIDVKLKSRSDKEKSCTVSESYKQIDCDTY
EATRLQKLLLHSIGGWPLYTIVLAIGQILGASSYQLTLLSGESAQSTVSMYILLSIFSFF
SLFWWFLSRVVQARYILSLPFFFFGISFILVAITHFFQKTTACSVIQHIAAYVYAISSST
GSLYFAWNFGAEGGIATHHWILRACLVHGIQQIWSAILWSWGDLLSKKDLTQNVGPGIFA
GGLIASFICFGLSYVTFAGLPAFYRQAPSIIPAFYRSLGKRNIVIWFFISQILINYWLAV
PYGQAWRFFWNTSNTPLWSIIILLLIFFIVVWAVLLSVIKILSLNNVWFPVIFGLGLICP
RWCLEFWSSSGLGINLPWAGKASALLTKSVWLLLALWDGIQGVGVGVMLLQTLARDHVAF
TLMLAQVISCITIMIAKPSLPVSDRVFPNLGAWNPSEGPGPCASPCFYIALICQFVAVGG
LLYHYRKSQLAL
NT seq 7059 nt   +upstreamnt  +downstreamnt
atgctcttctttagcatacctacaattttgttaatatttttcctatttatccaaattata
acagcagccttccttactgatgaaaatgaaccttggaatctaaatcgtaattggacagct
caaaaaattttggattatagtgccgaatggaattctcatgagtattttccttctccatct
aactggagagcgctacctttttacaccattatcctggataaatggaccaacggagttccc
gaaaatgatgttgctgaagatactgtctttgaatctgacccttatgaagttacatttcgg
gcaggtggtgatattgttggacttgtaactccaaggtccctagattatcttgaaagcatg
ggcattaaagctgtttatatagctggtacaccgttccagaacttgccttggtacccagat
ggctactctccccttgattttactttgctcgacaagcatactggaactctcaatcaatgg
catgaagcaataatgaaattgcatgagagagggttttatgtagtagttgattttactata
tctactctttctgagcttagctatttcgtgaattcttcaatgtcgttcgcgaatacttct
gctccttttagcaccaaaggatataaaatgaagtataagcacccagaatatcattacaca
gattttcaattgtctaacgggtcttcgtattcttgtaatgcccctaccttttgggatgtt
acgggtcttccaatcaataataccgaagaccttaattcgatttctgaagttatgtgtcta
agtggtgatttcgaccactatggagatgtcgaagcttttggtaatcatcctccttggtgg
cgccaactgtcaaattttgcttcagtgcaagatagattgagagattgggacccaattgtt
gctaaaaagcttaaacatttaggatgtttagctgtaaaaatgctcgatattgatggaatc
cgtgttgataaggccactcaaattacagctgatttccttggagattggagcgcttatatt
cgccaatgtgctcgtgaaataggaaaagagaatttttttattcccggtgaagttactagt
ggcgctgattttggctcaatatatgtcgggcgtggtcgtcaagcagatcagcgccccaat
aaccgagaaatagctttgcagactggttataatgaatcaaaatacttcttaaggaaagaa
tccgattcagctcttgactccgtttcatttcactactcagtatatcgtactctaacatta
ctgcttggtctgcagggagaactatttgctgcattcgatcttaatcgtcatgactttgct
gccatgtggaaccaaatgctgattcaagatgatatgataaacgctaataccaaaaaattt
gatcctagacatctttatggtttgacaaatcaagatattttccgttggccctccattaaa
gatggaagattcaaacagcttttggggctttttgtagtacacctacttatgcccggtatt
cctctaatttattatggggaagagcaaaatctcaaattacttgataaccaagcagcaaat
tatatattcggtcgccagcctattacttcttcgattggatggcaaaagcatggctgttat
caaattggcactactcagtatactgacttagactttggacctgcaagtgaggcatgtagg
gacgattggaacagtttggaccatcttgatcccacttctcctactaagcattatattgcc
agaatgaacgagattcgctcttatttccctcaagttagagacggatgggacttgaaattg
ataggtaaatggacgcatgaaggtactttccctggtaatgaattatatggtgaatcaaat
ccaacaacttgggggttatggtcaatgataagaggacctcttgcaccatatcaaaaattt
tctgatcaaaatgattacatttggcttattttcacaaatgagaatactaccaagacatac
gacatggattgtatgagacaagttgataacaaatttcctccgtatccggcgcttttaggc
ccttattcttctggatctacagtaaagaatcttctttacccttacgaggaaatcgacctt
agtacctcaactattgattctccagatattggaaatatcggatgcatccctcacttaact
attgacgcatacggatctaaaatatttgttaaaaaagaggactggattagaccttcttta
tatttgaccaaattcttaccgggccatgattctcgtatatactcagcaactgaagttaca
tctttcaaaattagtcttggtttttcagaagaagtcgattgtaaagatctatttaaacgt
atcggctttaattcgcgtacattaaatagttcatttgctccaaaaattctagaagatagc
atttcttgcggatatttggatcaacctgcacctcaagaatacacgaatgctccagttaca
aagtggtttttcaatgctactcttgattccgtcccgaacgggatgcacgagttactttta
aatgaagttaaaagtacatccaatcaaacaatgcaatcaaaaattgctagactcatattt
cgagtaggaaatgaggaaaatcctttggtctatccaaataatgctaccttcagcccttct
cttctttataaagctagtaacggagacttatacgtaaatcacactggtgctggcgctgat
aagtatcggttctcattgaactatggtggaacgtactcaaaatggaaaactgtatcaact
ccctccgagaagctgcgaaaaccgacctggaacggcactaatttgcaaaaatgggatggg
gaccatcttatagttcaatactggtctagtatcgctctttctactgctcacgttcagcat
ggtgatacgttaaattattctcgtcaatttcctaatcttttcgttcaaggtgcgtttaac
agatttggctacgatggttcaatgccaagtaagatgtcatataatttagagaatcggact
tggagttatgatttaatttcaacttggcctgctgaacttgttctaaacgtttggggcatg
aatccagacaataatgccgatcaaggatgggtttacggtgatttagataatgatactata
attgatagagttcccccaggaagtagtcgtatatctaattttattcgtttccttgatccg
cccccgaaaccatacctttcttataaaatgtatctgaacgattttacgaggcagttacat
tatattccaaagggttcttggacagttcaaatcgttgccattgttctactgattcttctt
ccacccctatttggtattttttcggtagctttgtacagcggcgcattttccagagttacc
atttttaacggctcccataataggggcataaaagttgcgaaacaaaagatcaagagcata
atgtctcggatatttccatttagtgttcatttacctctcgacaatagttcagaattgctc
aaacagcttccagagtctgaaaaacgattaaatgttcttgtagccaccttagaatatgat
gtacccgatctgggcattcgagttaaaataggcggtttgggagtaatggcacaactaatg
ggacagcacatggagtttcaagatatggtatgggtcgttccaataataagtggtgtcgaa
tatccattcgataaactttgtacagaacccaagattgctgttaaaattggtgatgatgaa
tttgttgttaactgctattcatataaatcgggaaatataacatacgtctttctgcaatca
gaagttttttacaagcagtctagtaaagaaccatatccattaaaaatggatgacttggct
tcggcaattttttattctgtttggaaccaatgcattgctgaagtttggaaaaggtttccg
ttagatatatatcatgtgaatgattatcatggagcacttgctcctctctatttattacca
gaagttatacctgtagctgtgtctttacacaatgccgagttccaaggattatggcctctc
cgtacgtcggctgagcttgaatgtgtttgctcaatttttaacattgaaaaggacatttgt
accaagtatgtacaatttggacatgtttttaatttgttgcattctattatctcttatgtt
cggaaacatcaaggagggtacggcgttgtagcggtctcagataaatacagtaaacaaact
ctgtcaaggtatcctattttttggagtctcgttcatattagtggattgccaaatcctgac
cccagtgatcttaaattgcttaatcatcttacagatgatcccgttgatgttgactttgtt
ttggaagcgaaaagaaaattgcttaaaaaacagacacaagaatgggcgaatttggatgtt
gatccttcagcacaattactagtatttgttggtaggtggtcacatcaaaaaggcatagat
ttgattgctgatcttgctcctaaacttttgacggaacacaatgtgcagttgattacgatt
ggtcctgtgattgatttgcatggccaattcgcagcagaaaaacttgagcaaatagccaaa
cgttttccgactcgagttctatgcaagccagtatttacggcggttcctccttttctgttc
gctggaactgattttgcattaattccttctagagatgagccatttggtttggttgctgtc
gagtttggaagaaagggtgttctgtgcattggttcaagaacaggagggcttggtcatatg
cctggttggtggtttcaaatggcatcacctaacacagggcatttgcttactcaattcgaa
aatgcaataacgaaagctctccacagcaacggtgagctgagggctcgacttcgagttgaa
gctttacgccaacgatttcctgtttgcatttggaaacagaaatcggaaaatttgttgaaa
tcgtgtatatatgtgcatgaaatggaaacactcaagcatgccagcccaacctttaaagcg
tatcaattcgttgtacgcatctgtcattacttaacttctaaggttaaatcaataaataag
gatcaagtttttaatgctttctcacccgatgtttcagaacgccctccattatttgaagta
gcctcttgttcaaatgaaactgactctgtggagaagctaacacctgagttatccgtttcg
ccagagtcggatatgcattttaaagatgggaattcaagtaaattagaaattgttgaaagc
aaggaaatttacgcgtctgacagtgatataagtaatagtacatccgaggatatcaataaa
gatgaatgtgtctctaaagacatagaagtcgataattttgcactcaacttgcagtctcag
tcttacgaaggagattctaatgatttcggaattcgcgaggttccactctctgatgcaaac
caatcgtcacaagccgattcaacttcaatcgatagatatggaccctatagctcacaaaaa
gttaacttttctaaatataaagattttgttgaatcgcgacctacattttttcaaagttct
gttacattcacggatgctgatggttctacaaggaaaactttctcaaagaggcttgaaaat
ttgactacgtctaacacccttaaatctttatcagttgaccattttattcgtaagcatgag
agaaagtacttcaatggactaaggaagcaagaaattgatgtgaaattaaagtctcgctca
gataaagaaaagagttgcacagtctcggagtcttacaagcaaattgattgtgatacatat
gaagctactcggttacaaaaattacttcttcacagtattggtggatggcctctatatacg
attgtattggcaattgggcaaattcttggagcatcttcttatcaattaactttactttct
ggagaatctgcgcaatctacagtgtccatgtacattctgctctctattttctcattcttc
tctctgttttggtggttcttatcccgagtggttcaagcgagatacattttatctctccct
ttcttcttttttggcatatctttcattttagttgcgatcactcactttttccagaaaact
actgcttgttcggtaattcaacacatagcggcttacgtttatgccatttcaagttctact
ggatcgctgtattttgcatggaattttggtgccgaaggaggtatcgcaactcatcattgg
attttgagggcctgtcttgtacatgggattcaacagatttggtctgcaatcctctggtca
tggggagatctattatcgaagaaagatttgactcaaaatgtggggcctggcatttttgca
gggggacttatcgcctctttcatttgcttcgggctttcctacgtaacattcgcaggttta
cctgctttttatcgccaagctccttctatcattccagcgttttatcgttcattaggaaaa
cgaaatattgtaatttggttttttatctctcaaattttaatcaattactggcttgctgtc
ccttatggccaggcttggaggtttttctggaatactagcaacactcctttgtggagcata
atcattcttttactcattttcttcatcgtggtttgggccgttctcttatcagttataaag
attttgtctcttaataacgtttggtttccagtgatatttggattgggcctcatttgtcca
cgctggtgcttagagttttggtcatcctcgggtctcggaattaatttaccatgggctggt
aaggcttctgccttgctgacgaagtcagtatggcttttgctagctctatgggacgggata
cagggagtcggtgtcggtgtaatgttactgcaaaccctggcgagagatcatgttgctttc
acgttgatgctagcgcaagttataagttgtattacaattatgatcgcaaaaccttctctg
cctgtaagtgatcgagtattcccaaatcttggtgcatggaatcctagcgaaggaccggga
ccttgtgcatcaccttgcttttatattgcactaatatgtcaatttgtagctgttggagga
ttgctctatcactatcgtaaaagtcagcttgctctttag

DBGET integrated database retrieval system