KEGG   Schizosaccharomyces pombe (fission yeast): SPBC336.01
Entry
SPBC336.01        CDS       T00076                                 

Gene name
fbh1
Definition
(RefSeq) DNA helicase I
  KO
K10300  F-box protein, helicase, 18 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPBC336.01 (fbh1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPBC336.01 (fbh1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     SPBC336.01 (fbh1)
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 Viral_helicase1 UvrD_C_2 AAA_30 PhoH F-box
Other DBs
NCBI-GeneID: 2540244
NCBI-ProteinID: NP_596121
PomBase: SPBC336.01
UniProt: Q9USU3
Position
II:join(2733296..2735105,2735146..2735972)
AA seq 878 aa
MSAQHLHSCKFYRLPLEIIPLICRFLSVQDIQSFIRVFPSFQTILDSSNDLFWKKKNYEL
RIRRNRLLRGSYAAGVSSSAMNGFVNGTQISSTPAEREYYSKSDEIKNICGLPPGPMKVE
QIGHAIDHLVSETHTVDHLGSSIKASFFHIDDVPLEWISSICMQVQSFFSPAAREAISSL
KSRTTTSNLLLSLFVGILFEDDLWYFFNTLYMLSSTSAIEFAYFLDSIFTVVRTDYEHYR
DPLSQTLITSCTRIHNIVAVIESPYDEPNTKGLTSEQKMIVECQLNPGEVLKVKAFAGTG
KTKALLEFAKSRPKDKILYVAFNKAAKEDAELRFPFNVKCSTMHGLAYGAILAQADLPQA
KLERQLSNSTIASLLSLQVAFPKANRKNNPGTPSASLVASHIMFTLNRFMHSTDWQLGFR
HISKRSLEVTKLSKEKLLAYTKKLWSLIVNFEYTHAPLIPDAYMKLLHLYEFPNIFSKYD
YILFDEAQDFTPCMVDLIYRQKHARIVIVGDAHQCIYGFRGANACAFNENLYPSTKQLCL
TKSFRFGNSVAKYANFLLSLKGENVKLKGVQNDHAYWSSASNPNNVSGAFRFFPHTIIFR
TNKELILQSIRLSVSLPKEIPIAILGSMRKKAFQLLRSGSELAHGQRPSHPKLKDFSSWG
EFEVHVKNSAEEDAELALVYDMADELFSESFLSRLDNCEKRLMDSKDDGDNGIILATAHQ
SKGLEWDNVQLGNDFRPKFDSVSFSRIGSSRYLQEEINILYVALTRAKKRLILNDTITKL
YALECGLVRFAGGILTEDQLQPGKVALFVDWQIDKFSFFYETPAEGYNLLVEANEKSVWD
IFFGVLSGAWQNYIANTSERLKRSMLFIENQLFAVHDQ
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgagtgctcaacatttacatagctgcaaattttatagactgccacttgaaattatccca
ttgatctgcaggtttctttctgttcaggatatccaaagtttcatacgtgtattcccatcc
tttcaaactattttagactcttctaatgaccttttttggaaaaagaaaaattatgagtta
cgaattcgtcgaaatcgattgcttcgtggttcttatgctgctggtgtttcgagctcagcg
atgaatggatttgtcaatggcacccaaatttcatccacaccagctgagagagaatactat
agtaaatcagatgaaataaaaaatatttgtgggcttcccccgggtcctatgaaagtggaa
caaattggacatgctattgaccatcttgtcagtgagactcatacagttgatcatcttgga
agttctattaaagcatctttttttcacatagatgatgttcctttagaatggataagctca
atatgcatgcaggttcaaagctttttctcccctgcagctcgagaagctatatcttctcta
aaaagtaggactactactagcaatctgcttttaagtttgttcgtagggatactatttgaa
gatgatttgtggtattttttcaatacgctttatatgctatcttcaacgtccgctatagaa
tttgcttattttctggactctatctttactgtagtccgcacagattatgaacattatcgt
gacccactttcacaaacactaattacttcgtgtactaggattcacaacattgtagctgtc
attgaatccccttatgatgaacctaacactaagggccttacctctgaacaaaaaatgatt
gttgaatgtcaattaaacccaggagaggttctaaaagttaaagcattcgctggtactggc
aaaaccaaagcattattggaatttgccaagtctcgtccaaaagataaaattttatatgtt
gcttttaacaaggccgcaaaagaagacgcagaattacgatttccatttaatgtcaaatgc
tccaccatgcatggtcttgcttatggtgctatacttgcacaggccgatttgccgcaagct
aaacttgagcggcaattatcaaattctactatagcttcacttttgtctttgcaagttgca
tttccaaaggcaaatcggaaaaataatccgggtacaccatccgctagcttggtagcttct
catatcatgtttacattaaataggttcatgcactccactgactggcagcttggttttcgt
catataagtaaaagaagcctggaagttacaaaactctctaaagagaagcttttggcttat
acaaaaaaattgtggtctcttattgtaaactttgaatatacccatgctcctctcatacct
gatgcatatatgaaattattacatttgtatgaattccctaatattttttcaaaatatgac
tacattctttttgacgaggctcaagattttactccgtgtatggtcgaccttatttatcgt
cagaaacacgcccgaattgtcatcgttggggatgcacaccaatgcatttatggttttcgt
ggtgcaaatgcatgtgctttcaatgaaaatttgtacccttccacaaagcaactgtgcctt
actaagagtttccggtttggaaactctgttgcaaaatatgcaaattttttgctttcatta
aagggagagaacgttaagcttaaaggggtacaaaatgaccatgcgtattggtcttcagca
agtaatcccaacaatgttagtggagcgtttcgattttttcctcatacgattatttttcgc
actaataaagaattaatcctacaatcgattcggctatcagtgtcattacctaaggagata
cccattgctattcttggctcaatgaggaaaaaagcattccaacttttgcgaagtggttca
gaactagcgcatgggcagcgcccttcgcacccaaagttaaaagacttttcctcttgggga
gaatttgaagtgcacgtaaaaaactcagccgaagaagatgccgaattggctttagtatat
gatatggccgacgaattatttagtgaaagctttctgagccgattggacaattgtgaaaaa
agattgatggactctaaagacgatggtgacaacggtattattttggcaacagcacatcaa
tctaagggtcttgaatgggataatgttcaattgggtaatgattttcgaccaaaatttgat
agtgtttctttttcacgaattggatcttcgaggtacttgcaagaggaaatcaatatcctt
tatgttgctcttacgcgagctaaaaaacgccttatccttaatgacactataaccaaatta
tacgcattagagtgcggacttgttcgttttgctggtggcattttaacggaagatcagctg
caacctggaaaagttgctctttttgtcgactggcagattgacaagtttagctttttttat
gaaacccctgctgaaggatacaatcttttggtcgaagcaaatgagaaatcagtatgggat
atattttttggagttctttcaggcgcttggcagaactatattgcgaatacatctgaacgg
cttaaaagatcgatgctatttattgaaaatcaattgtttgctgtacatgatcagtag

DBGET integrated database retrieval system