KEGG   Schizosaccharomyces pombe (fission yeast): SPBC336.04
Entry
SPBC336.04        CDS       T00076                                 
Symbol
cdc6
Name
(RefSeq) DNA polymerase delta catalytic subunit Cdc6
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
spo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC336.04 (cdc6)
   03410 Base excision repair
    SPBC336.04 (cdc6)
   03420 Nucleotide excision repair
    SPBC336.04 (cdc6)
   03430 Mismatch repair
    SPBC336.04 (cdc6)
   03440 Homologous recombination
    SPBC336.04 (cdc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC336.04 (cdc6)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC336.04 (cdc6)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SPBC336.04 (cdc6)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    SPBC336.04 (cdc6)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SPBC336.04 (cdc6)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     SPBC336.04 (cdc6)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 divDNApol
Other DBs
NCBI-GeneID: 2540255
NCBI-ProteinID: NP_596124
PomBase: SPBC336.04
UniProt: P30316
Position
II:2743619..2748596
AA seq 1086 aa
MTDRSSNEGVVLNKENYPFPRRNGSIHGEITDVKRRRLSERNGYGDKKGSSSKEKTSSFE
DELAEYASQLDQDEIKSSKDQQWQRPALPAINPEKDDIYFQQIDSEEFTEGSVPSIRLFG
VTDNGNSILVHVVGFLPYFYVKAPVGFRPEMLERFTQDLDATCNGGVIDHCIIEMKENLY
GFQGNEKSPFIKIFTTNPRILSRARNVFERGEFNFEELFPVGVGVTTFESNTQYLLRFMI
DCDVVGMNWIHLPASKYQFRYQNRVSNCQIEAWINYKDLISLPAEGQWSKMAPLRIMSFD
IECAGRKGVFPDPSIDPVIQIASIVTQYGDSTPFVRNVFCVDTCSQIVGTQVYEFQNQAE
MLSSWSKFVRDVDPDVLIGYNICNFDIPYLLDRAKSLRIHNFPLLGRIHNFFSVAKETTF
SSKAYGTRESKTTSIPGRLQLDMLQVMQRDFKLRSYSLNAVCSQFLGEQKEDVHYSIITD
LQNGTADSRRRLAIYCLKDAYLPQRLMDKLMCFVNYTEMARVTGVPFNFLLARGQQIKVI
SQLFRKALQHDLVVPNIRVNGTDEQYEGATVIEPIKGYYDTPIATLDFSSLYPSIMQAHN
LCYTTLLDSNTAELLKLKQDVDYSVTPNGDYFVKPHVRKGLLPIILADLLNARKKAKADL
KKETDPFKKAVLDGRQLALKVSANSVYGFTGATNGRLPCLAISSSVTSYGRQMIEKTKDV
VEKRYRIENGYSHDAVVIYGDTDSVMVKFGVKTLPEAMKLGEEAANYVSDQFPNPIKLEF
EKVYFPYLLISKKRYAGLFWTRTDTYDKMDSKGIETVRRDNCPLVSYVIDTALRKMLIDQ
DVEGAQLFTKKVISDLLQNKIDMSQLVITKALSKTDYAAKMAHVELAERMRKRDAGSAPA
IGDRVAYVIIKGAQGDQFYMRSEDPIYVLENNIPIDAKYYLENQLSKPLLRIFEPILGEK
ASSLLHGDHTRTISMAAPSVGGIMKFAVKVETCLGCKAPIKKGKTALCENCLNRSAELYQ
RQVAQVNDLEVRFARLWTQCQRCQGSMHQDVICTSRDCPIFYMRIAEHKKLQQSVDLLKR
FDEMSW
NT seq 3261 nt   +upstreamnt  +downstreamnt
atgacagataggtcttcaaatgagggcgtcgtgttaaataaagaaaactatccatttccc
cgaagaaatggttcaattcatggcgaaattacagatgtcaaacggcgacgtttaagcgaa
agaaatggatatggtgataaaaagggctcatcctcaaaagaaaaaacttcatcttttgag
gatgagctggctgaatacgcttcacaattggaccaagatgaaataaaatcttcaaaagat
cagcagtggcaacgaccagctttacctgcaataaatcctgagaaggatgatatttatttt
cagcaaatcgatagtgaggagttcacagaaggatctgtaccttcaattcgtttgtttggt
gttactgacaatggaaacagcatccttgttcatgttgtgggattccttccgtacttttat
gttaaagccccggttggatttcgacctgagatgctagaacgtttcacacaagatttagat
gctacttgtaatgggggtgtgatcgatcattgcattatagagatgaaggaaaatttatat
ggatttcagggaaatgaaaaatctccattcattaaaatctttactactaaccctcgtata
ttatctcgagcacgaaatgtatttgaaagaggagaattcaacttcgaagagcttttccct
gttggtgtcggtgtcactacttttgagagcaatacgcaatatcttcttagattcatgatt
gactgtgatgttgttggtatgaattggattcatcttcctgcttcaaaatatcaatttcgt
taccagaatcgagtttctaattgtcaaattgaagcttggattaattacaaagacttgatc
agtcttccagctgaaggccagtggtctaaaatggccccactgaggatcatgagctttgat
attgaatgcgcaggtcgcaaaggcgtttttcctgatccctctattgaccctgtaattcaa
attgcaagtatagtaacgcagtatggagactccactccttttgttcgtaatgtcttttgt
gttgatacatgctcacaaatcgttggaacacaagtatatgaatttcaaaatcaggctgaa
atgctttcaagttggtcaaaatttgttcgtgatgttgacccagatgttttaattgggtac
aacatctgcaactttgatatcccttacctcttggatcgagcaaaaagcttacgcattcac
aatttcccattacttggccgtattcataattttttttctgtcgcaaaggaaaccacgttt
tcaagtaaagcatatggtactcgtgaaagcaaaaccactagtattcctgggcgtttgcag
cttgatatgttacaagtaatgcagcgtgattttaagcttcgatcttactctttaaatgca
gtctgctctcagtttctaggcgagcaaaaagaagatgtacactattctatcatcactgac
ttgcaaaatggcactgccgattctagaagacgtttagctatttattgtctgaaagatgca
tatttaccccaacgcttaatggacaaattaatgtgttttgttaactatactgaaatggca
agagtaacaggtgtaccgtttaattttcttcttgctagaggccaacagattaaagttatt
tctcaattgtttcgcaaagctcttcaacatgacctagttgttccaaatatacgtgtaaat
ggaacagatgagcaatatgaaggtgctacagtcattgaaccgattaaaggatactatgat
acccctattgcaacactggattttagttcactttatccttcgattatgcaagcccataat
ttatgctatacgacattacttgactcaaatactgcagaattattaaaacttaagcaagat
gttgactactcagtgactccgaacggagattatttcgttaaaccacatgttcgtaaagga
ctactccctattatcttagctgatttacttaatgcacgtaagaaagcaaaagcagatcta
aaaaaggaaacggacccattcaaaaaggctgttttggatggtagacagctagctttaaaa
gtaagtgctaattcagtatatggatttactggtgctaccaacggacgtttgccgtgttta
gcaatttcttcttctgttacctcttatggtcgacaaatgattgaaaaaaccaaggatgtt
gtagaaaagagatacagaattgagaatggatactctcacgatgcagttgtaatctatggt
gacactgattctgttatggttaagtttggcgttaaaacgttacctgaagccatgaaatta
ggagaggaagcagctaattatgtttcagaccagtttccgaatcctattaaactggagttt
gagaaagtgtactttccatatcttttaatttccaaaaaacgttatgcaggattattttgg
actcgtacagatacttatgataaaatggactctaaaggaatagaaactgtcagaagagat
aactgtcctctagtatcttatgtgattgacacagctttgagaaaaatgttaattgatcag
gatgtagagggtgcacagttgtttacaaaaaaagttatttccgatttgttacaaaacaaa
attgatatgtcacaacttgtaatcacaaaggcattatcaaaaactgattatgctgccaaa
atggcacacgttgaattggctgagcgaatgcgtaaacgagatgctggctccgccccagcc
ataggagatcgcgttgcatacgttattattaaaggtgcacaaggtgatcaattttatatg
aggtcggaggaccctatatatgtattggaaaataacattcctattgatgcaaaatattat
ttggaaaatcaactctccaaacctttgcttagaatttttgagcctattcttggtgaaaaa
gctagctctttacttcatggtgaccatactcggacgatttccatggcagcccccagtgtt
ggaggaataatgaaattcgcagtaaaggttgagacctgtcttggatgcaaagctcccata
aaaaaaggtaaaactgctttatgtgagaattgtctaaatagatcggcggaactgtatcaa
cgtcaggttgctcaagtgaatgatttagaagttcgttttgctcgcttatggactcaatgt
cagcgatgccaaggaagtatgcatcaagacgtcatttgtaccagtagagactgccccata
ttttatatgcgaattgcagaacacaagaaacttcagcaatctgttgacttactgaaaaga
tttgatgaaatgtcctggtga

DBGET integrated database retrieval system