KEGG   Schizosaccharomyces pombe (fission yeast): SPBC337.05c
Entry
SPBC337.05c       CDS       T00076                                 

Gene name
cct8
Definition
(RefSeq) chaperonin-containing T-complex theta subunit Cct8
  KO
K09500  T-complex protein 1 subunit theta
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPBC337.05c (cct8)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC337.05c (cct8)
Chaperones and folding catalysts [BR:spo03110]
 Heat shock proteins
  HSP60 / Chaperonin
   SPBC337.05c (cct8)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    SPBC337.05c (cct8)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 2540305
NCBI-ProteinID: NP_595406
PomBase: SPBC337.05c
UniProt: P78921
Position
II:complement(join(1038547..1039902,1040189..1040310,1040363..1040402,1040456..1040578))
AA seq 546 aa
MALRVPKASGPQLFREGYRIMQGVEDAVIRNCNAIRELSEITRTSLGPNGKNKIVVNHLQ
QTFLTNDAATIIRELEVIHPAAKLVVDATQQQENELGDAANFVVVFTGELLAKAENMIRM
GLTPLEIAKGYEMALSHTMEVLEEICADKIETVESEKELIKAIRTCISSKQYGNEDFLSD
LVAKAILTVLPKDPSKFNVDNIRVVKIMGSSLYNSQVVKGMVFPREPEGTVTRSKEAKVA
VFSCPLDISQTETKGTVLLHNAQEMLDFSKGEENLIESHIKEIYDAGVRVVVTSGNVNDL
VLHYLNRFEILVIRVPSKFELRRLCRVVGATPLARMGVPMPEEMGSVDVVETIEIGGDRV
TVFRQVEDITRTATIVLRGATKTYLDDLERAIDDGVNIVKALVKDNRLIFGAGASDMQLC
IRLISVGEKTPGIYQHAIKQYGEAFEVVPRTISENAGLDPTDVISKLYAAHHKENGESIG
VDVECENDGTLDAKEAGIFDVLLAKKSAIRLATETVLTVLNVDQVVMSKPAGGPKPPGPN
PHWDDD
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggctttgcgagttccaaaggcctctgggcctcaactgtttcgcgaaggatatcggatt
atgcagggcgtagaggatgcagtaatccgtaattgtaatgctattcgtgaactttcagaa
atcacccgtacctctttgggtccaaatggaaaaaataaaattgttgtcaatcatctgcaa
cagacgtttttgacgaatgatgctgcgaccattatacgtgaattggaggttattcatcct
gctgctaaactagttgtcgatgctacccaacaacaggagaatgagcttggtgatgctgca
aattttgtggttgtatttacaggtgaacttttagccaaggctgaaaacatgattcgcatg
ggtctcactcccttggaaattgctaaaggatacgaaatggctttatcacacactatggag
gttttggaggaaatttgtgctgataaaattgagactgttgaaagtgagaaggagcttatt
aaagcaattcgaacttgtatatcttctaagcaatatggaaatgaagatttcctttcggat
ttagttgctaaagcgatcctcacagttcttcccaaagatccatccaagtttaacgttgac
aatatccgtgtggttaaaattatgggaagtagcctttataactctcaggttgtaaagggc
atggtatttcctagagagccagagggcaccgttacacgttcaaaagaagctaaagttgct
gttttttcatgccctttggatatttctcaaaccgaaacaaaaggcacagtattgttgcat
aatgctcaagaaatgcttgacttttctaaaggagaggagaaccttattgagtctcacatt
aaagaaatttacgatgctggtgttagggtagttgtcactagtggcaatgtcaatgactta
gttttacattatttgaatagatttgaaatccttgttattcgtgtgccaagcaaatttgaa
ttacgtcgcttatgtcgggtggttggcgctaccccgttggctcgtatgggtgttcccatg
cctgaagagatgggatccgtcgatgttgttgagacgattgagattggtggtgatcgtgtc
actgtattccgtcaagttgaggatattacacgtactgcaacaatcgtgcttcgaggggct
actaagacatacttggatgatttggaaagagcgattgatgatggtgtaaatatcgtaaaa
gctttggtcaaagataaccgtttaatctttggtgctggagctagtgatatgcaactctgt
attcgtctaatttcagttggtgaaaaaactcctggtatatatcaacatgcaatcaaacag
tatggagaagcatttgaggttgttcctaggactatttcagaaaacgctggattagatcct
actgatgttattagcaaactttatgctgcccatcataaggaaaacggtgaatcaattgga
gttgatgttgaatgtgaaaatgatggaacattagatgcgaaagaagctggtatatttgat
gttttattagcaaaaaaatcagcaattagattagcaactgaaactgtactcactgtttta
aacgttgatcaagttgttatgtctaaaccagctggaggtccaaaaccacctggccccaac
cctcattgggatgatgattaa

DBGET integrated database retrieval system