KEGG   Schizosaccharomyces pombe (fission yeast): SPBC337.08cHelp
Entry
SPBC337.08c       CDS       T00076                                 

Gene name
ubi4
Definition
(RefSeq) ubiquitin
  KO
K08770  ubiquitin C
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPBC337.08c (ubi4)
Ubiquitin system [BR:spo04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   SPBC337.08c (ubi4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_5 Rad60-SLD_2 DUF2407 Sde2_N_Ubi
Motif
Other DBs
NCBI-GeneID: 2541030
NCBI-ProteinID: NP_595409
PomBase: SPBC337.08c
UniProt: P0CG72
Structure
PDB: 

Position
II:complement(1044418..1045566)
Genome map
AA seq 382 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcagattttcgtcaagacattaactggaaagactattacattggaagttgaatcttcc
gataccattgacaatgtaaagagcaagattcaggataaggaaggcattcctcctgatcaa
caacgtcttatttttgctggtaagcaacttgaagatggacgtactctttcagattacaac
attcaaaaggagtctactcttcaccttgttcttcgtcttcgtggcggtatgcaaattttt
gtcaaaaccttgactggtaaaaccattacattggaagttgagtcttctgacaccattgat
aacgtaaagagcaagattcaggataaggaaggcattcctcctgatcaacaacgtcttatt
tttgctggtaagcaacttgaagatggacgtactctttcagattacaacattcaaaaggag
tctactctacatcttgttcttcgtcttcgtggcggtatgcaaatttttgtcaaaaccttg
actggtaaaaccattacattggaagttgagtcttctgacaccattgataacgtaaagagc
aagattcaggataaggaaggcattcctcctgatcaacaacgtcttatttttgctggtaag
caacttgaagacggacgtactctttcagattacaacattcaaaaggagtctactcttcac
cttgttcttcgtcttcgtggcggtatgcaaatttttgtcaaaaccttgactggtaaaacc
attacattggaagttgagtcttctgacaccattgataacgtaaagagcaagattcaggat
aaggaaggcattcctcctgatcaacaacgtcttatttttgctggtaagcaacttgaagac
ggacgtactctttcagattacaacattcaaaaggagtctactctacatcttgttcttcgt
cttcgtggcggtatgcaaatttttgtcaaaaccttgactggtaaaaccattacattggaa
gttgagtcttctgacaccattgataacgtaaagagcaagattcaggataaggaaggcatt
cctcctgatcaacaacgtcttatttttgctggtaagcaacttgaagatggacgtactctt
tcagattacaacattcaaaaggagtctactcttcaccttgttcttcgtcttcgtggcggt
cttttttaa

DBGET integrated database retrieval system