KEGG   Schizosaccharomyces pombe (fission yeast): SPBC342.02
Entry
SPBC342.02        CDS       T00076                                 

Symbol
qrs1
Name
(RefSeq) putative glutaminyl--tRNA(Gln) ligase Qrs1
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00970  Aminoacyl-tRNA biosynthesis
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPBC342.02 (qrs1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPBC342.02 (qrs1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPBC342.02 (qrs1)
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     SPBC342.02 (qrs1)
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SPBC342.02 (qrs1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPBC342.02 (qrs1)
 Prokaryotic type
   Other AARSs
    SPBC342.02 (qrs1)
SSDB
Motif
Pfam: tRNA-synt_1c tRNA_synt_1c_R1 tRNA-synt_1c_C tRNA_synt_1c_R2
Other DBs
NCBI-GeneID: 2540978
NCBI-ProteinID: NP_596745
PomBase: SPBC342.02
UniProt: Q9Y7Y8
Position
II:4203417..4205852
AA seq 811 aa
MDQDYEELRAKFTKIGLNETTVKDTLKNKKLSSSLNKVIEETNVGSSGCDRTIGNLLFTL
ANASLKQKDPKSNAHEAFIASKIVSGDLKTNLQVNAAITYCKDKDTIDESEFDKETGVGV
VLTPEQIEQLVGDYVAENKSKILEQRYQLLNPSASALRQHALLKWAPQLEVKQTLDRKFL
ELLGPKTEQDAAAGKKKGAKAKNSKQKTVDSGKAKEQKIVSEQSKKYNMFEEGFLAKLHK
PGGNTQLIPERMKEHLQATGGGVVTRFPPEPNGYLHIGHSKAIAVNFGFARYHNGVCYLR
FDDTNPEAEEERYFESIKDLVAWLGFQPYKITYSSDYFDKLYELAEELIKRDKAYVCHCT
DAEIKKARGGEERGPRYACVHRDRPIEESLLEFRNMRDGKYQPKEAILRMKQDLSDGNPQ
MWDLIAYRVLNSPHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFILSRVSYEWLC
NALEVYCPAQREYGRLNVVGTLMSKRKIMKLVKEGYVHGWNDPRLYTLVALRRRGVPPGA
ILEFVSEVGVTTAVSNIEVARFENCVRKFLENSVPRLMFLPDPIKVTLENLDDSYREQIE
IPFNPKDPSMGSRSAFLTKHIYIDRSDFREEASSDFFRLTLGQPVGLFRASHPVVAKRVV
KNDEGEPIEIIAEYDASSSKKPKTFIQWVSRDKESNSPVLIAETRLFNNLFKCDNPAALK
EQELAAQLNPESEVVLKNSIIEPGIYDLIKSAPWPKTDSSAGVDKAENPESVRFQAMRVG
YFCLDEDTKKPNHLVLNRIVSLREDSAKNKN
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggaccaggattatgaggagttacgtgccaagtttacaaaaataggattaaatgaaaca
acggtaaaagatacgttaaaaaataaaaagctttcttcttcattaaataaggtcattgag
gaaactaacgttggttcttcgggatgtgatagaacaattggaaatttgctatttacattg
gccaacgcttctttaaaacaaaaagacccgaaatccaatgctcatgaggcattcatagct
tccaaaattgtatctggagacttaaaaacaaacctccaagtcaatgcggctattacctat
tgcaaggacaaagacacgatcgacgaatctgagttcgataaagaaactggtgttggtgta
gtcttaacacctgaacaaattgaacaactcgtcggtgattatgtcgctgagaataagtca
aaaattttggagcaaagataccagctgttaaatccttctgcctctgctttacgtcagcat
gctttattgaaatgggctcctcaactggaggtcaagcagacccttgataggaaattcctt
gaactcttgggaccaaaaaccgaacaagatgctgccgctggtaaaaaaaaaggcgcaaaa
gccaagaattcgaagcagaagactgttgattctgggaaagctaaggaacaaaaaattgtt
tctgaacagtctaagaaatataatatgtttgaggaagggtttttagcaaagctacataaa
ccaggtggtaatacgcagctgattcctgaaaggatgaaggagcacctgcaggctactgga
ggcggcgttgtaaccaggtttcctccggaaccaaatgggtacctccatattggccattcc
aaagcaatcgctgttaattttgggtttgctcgctatcataacggcgtttgttatttacgc
tttgatgatactaatccggaagctgaagaagagcgttactttgaaagcatcaaggatttg
gtagcctggttgggattccaaccttataagatcacctattccagtgattactttgataag
ttatatgagttagccgaagagctcattaagcgggacaaggcatatgtttgtcattgtacc
gatgctgaaattaaaaaagctagaggtggtgaggagcgcggtcctcgttatgcttgtgtt
catcgggaccgcccgatagaagaatcgcttcttgaatttcgtaatatgcgtgatggaaag
tatcaaccgaaggaggctattttacgtatgaaacaagatctcagtgatggaaatcctcaa
atgtgggaccttattgcctaccgtgttcttaattctcctcatcctcgtactggagacaag
tggaaaatttacccaacttatgattttacccattgtttagttgattcgttcgagaacatt
tctcactctttgtgtacgactgagtttatattatctagagtaagttatgagtggttatgt
aatgccttggaagtttattgtcctgctcagcgtgagtacggtcgtttgaacgttgtcgga
accctcatgagcaaacgaaaaataatgaaattggtaaaggaaggatacgttcatggttgg
aatgatcctaggctatatacccttgtagctcttcgccgccgaggtgttcctccaggtgct
atccttgagtttgttagtgaagtcggtgtcactactgccgtcagcaatatagaagttgct
cgatttgagaactgtgttcgaaaatttctcgaaaacagtgtaccacgtcttatgtttctt
cctgatcctatcaaggttacattagaaaatctagacgactcttacagagagcaaattgag
ataccctttaatcctaaagatccttctatgggatctcgttctgcttttcttacaaagcat
atatacattgaccgttctgattttcgtgaggaagcatcttctgactttttccgtttgaca
ttaggtcaaccggttggcttgttccgtgcctctcatcctgtagttgccaaaagggttgta
aaaaatgatgaaggggaaccaatagaaatcatcgctgagtacgacgctagctcttcaaag
aagcctaagacctttattcaatgggtgtctagggacaaagaaagtaatagtccagtactt
attgctgaaacccgcctctttaataatcttttcaaatgtgataaccctgccgccctaaaa
gaacaagagctcgctgcacaattgaatccagagagcgaagtcgtactaaaaaattccatt
attgaacctggcatttatgatttaattaaatcggcaccttggcctaagactgattcatcg
gctggtgtcgacaaagccgaaaatcctgaaagtgtccgttttcaagctatgcgggttgga
tatttctgtttagatgaggatactaagaaaccaaatcatcttgtattgaatagaattgta
tccctcagagaagattcggctaagaataaaaattag

DBGET integrated database retrieval system