KEGG   Schizosaccharomyces pombe (fission yeast): SPBC354.14c
Entry
SPBC354.14c       CDS       T00076                                 

Gene name
vac8
Definition
(RefSeq) putative protein Vac8
  KO
K08332  vacuolar protein 8
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC354.14c (vac8)
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBC354.14c (vac8)
Membrane trafficking [BR:spo04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Other Cvt associated proteins
    SPBC354.14c (vac8)
  Other autophagy associated proteins
   Micronucleophagy associated proteins
    SPBC354.14c (vac8)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    SPBC354.14c (vac8)
SSDB
Motif
Pfam: Arm HEAT_EZ HEAT_2 Adaptin_N HEAT Arm_2 KAP V-ATPase_H_N
Other DBs
NCBI-GeneID: 2541010
NCBI-ProteinID: NP_595238
PomBase: SPBC354.14c
UniProt: O43028
Position
II:complement(join(583794..583960,584042..584935,585052..585411,585571..585691,585754..585836,585882..585909))
AA seq 550 aa
MGNCLSCCEKSKDEQYEPLLADREREAVADLLSFLEDRNEVNFYSEEPLRALTILAYSDN
LDLQRSAALAFAEITEKDVREVDRETIEPVLFLLQSPDAEIQRAASVALGNLAVNAENKA
LVVKLNGLDLLIRQMMSPHVEVQCNAVGCITNLATLDENKSKIAHSGALGPLTRLAKSKD
IRVQRNATGALLNMTHSYENRQQLVSAGTIPVLVSLLPSSDTDVQYYCTTSISNIAVDAV
HRKRLAQSEPKLVRSLIQLMDTSSPKVQCQAALALRNLASDERYQIEIVQSNALPSLLRL
LRSSYLPLILASVACIRNISIHPLNESPIIDAGFLRPLVDLLSCTENEEIQCHAVSTLRN
LAASSERNKRAIIEANAIQKLRCLILDAPVSVQSEMTACLAVLALSDEFKSYLLNFGICN
VLIPLTDSMSIEVQGNSAAALGNLSSNVDDYSRFIECWDSPAGGIHGYLVRFLSSEDSTF
AHIAAWTIVQLLEAGVPRLTAFIQSSDDIIELLNDIVARDANNGEYEDGEGDVILLSGRA
LHLIEQDTDS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgggcaattgcttgtcttgttgtgagaaatcaaaagatgaacagtatgagcctcttttg
gccgatcgggagagggaagctgttgcggatttattaagctttcttgaagatagaaatgaa
gtcaacttttacagcgaggagcccttacgtgctttaaccattttggcatactccgataac
cttgatctacagcgttcagcagcgcttgcgtttgcagaaattactgaaaaagatgttcga
gaagttgatcgtgaaactatagagcccgtcttgtttttactccagagtcctgatgctgaa
atacagagagctgccagcgttgctttaggaaaccttgctgtaaatgccgagaataaggcc
ttggtcgtcaaattgaatggattagaccttttaattcgtcaaatgatgtctcctcacgtt
gaagtccaatgcaatgctgtcggttgcattactaatttagctacccttgacgaaaataaa
tcaaaaatagctcattctggtgccttgggccctcttacccgtcttgccaaaagcaaggac
attagagttcaaagaaatgcaactggagcattgttaaacatgactcactcatatgaaaat
cgacagcaacttgtcagcgctggtactatcccagtgctagtatctttgcttcctagctct
gacactgacgttcaatactattgtactacttctattagtaatattgctgttgatgcagta
caccgtaaaagacttgcccaaagtgagccgaaactcgttcgttctcttattcaattaatg
gatacttcaagtcctaaagtccagtgccaagctgctttagcattaagaaaccttgcctct
gatgagcgttatcaaatagaaattgttcaaagcaatgccctaccctctttattaagattg
cttcgttcttcctaccttcctttaatacttgcttccgttgcctgtatccgtaacatttct
atacatcctttaaatgagtctccgataattgatgctggttttcttcgtccgttggtggat
ttattatcttgtacggaaaatgaagaaatacagtgtcatgctgtttctaccttacgaaac
ttagctgctagctcggagagaaataagcgcgctattatcgaagctaatgctattcaaaaa
cttcgctgtttaattttagatgctcctgttagcgtgcaaagtgaaatgactgcctgtcta
gccgttcttgctttaagtgacgaattcaagtcgtatcttcttaactttggtatttgtaat
gttttaatcccattgacagactctatgtcgattgaagtccaaggcaactctgcggctgct
ctgggtaatctttcttctaatgtcgatgattatagccggttcatagagtgttgggattct
ccagctggtggcattcatggttatctggtcaggtttttaagtagtgaagattctactttt
gcccatattgctgcttggaccattgtacaattactagaggctggtgttccacgtttaact
gcatttatacaatctagcgacgatatcatcgaattacttaatgacatagttgctagagat
gctaataatggagagtatgaagatggtgaaggcgatgttatattattatctggccgggca
ttgcatttaattgaacaggacacagattcttaa

DBGET integrated database retrieval system