KEGG   Schizosaccharomyces pombe (fission yeast): SPBC354.15
Entry
SPBC354.15        CDS       T00076                                 

Gene name
fap1
Definition
(RefSeq) L-pipecolate oxidase
  KO
K00306  sarcosine oxidase / L-pipecolate oxidase [EC:1.5.3.1 1.5.3.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00260  Glycine, serine and threonine metabolism
spo00310  Lysine degradation
spo01100  Metabolic pathways
spo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPBC354.15 (fap1)
   00310 Lysine degradation
    SPBC354.15 (fap1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SPBC354.15 (fap1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     SPBC354.15 (fap1)
    1.5.3.7  L-pipecolate oxidase
     SPBC354.15 (fap1)
SSDB
Motif
Pfam: DAO FAD_binding_2 NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox_2 Thi4 FAD_binding_3 Pyr_redox AlaDh_PNT_C
Other DBs
NCBI-GeneID: 2540916
NCBI-ProteinID: NP_595239
PomBase: SPBC354.15
UniProt: O43029
Position
II:586543..587781
AA seq 412 aa
MVKNTSVIIVGAGVFGLSAALELTKRGGYTIKILDRAPPPVIDGSSVDANRIIRSDYADA
VYCSMGIDALEEWRTNPLFKEQFYGSGLMFVGRDNVEYRDMSLENLTKMGVSAAKFQTTE
ELRKLFPKWIGELNDGEAGYANFSSGWANAEQSVKSVVNYLAHAGVSFISGPEGTVEELI
TEENVVKGVRTTTGAYMAEKLIFATGAWTASLLPNDHTRFLATGQPVAYIKLTPEEYIRF
LTNPVYLDFDTGFYIFPPTPDGYLKFARHGYGFTRMQNLKSGKVESVPPKKPLVSPILPK
EAELDLRRNLQRTYGEEISQRPFYKTRICYYTDTADAEFVFDYHPDYENLFVCTGGSGHG
FKFFPILGKYSIGCMFRELEEPLLKKWRWKKENLEFAALDHSRAGPSRQELS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggtaaagaatactagcgtaatcattgttggtgcaggtgtgtttggattatctgcagct
ttagagttgactaaacgtggtggatatacgatcaaaatcttggatcgagcacctccgcct
gttatcgatgggtcttcagtcgatgcaaatcgtataattcgttcagactatgcggatgca
gtgtattgttcaatgggtattgatgctttagaggaatggcgcacaaatccactttttaaa
gagcaattttatggatcaggacttatgtttgttggccgtgacaatgttgagtatcgggac
atgagtctggaaaacctgacaaaaatgggtgtgtcagcagcaaagtttcaaactacagaa
gaattgcggaaactttttccaaaatggattggcgagctgaatgatggagaagctgggtat
gccaattttagttctggatgggccaacgctgagcagtctgtgaaatccgtagttaattac
ttagcacatgccggtgtttctttcattagcggacctgagggaactgttgaagagcttata
acagaagaaaacgttgttaaaggcgtgaggactactactggagcttacatggccgaaaaa
cttatttttgctacaggtgcatggactgcatctcttttacctaatgaccacacacgattc
ttggcaaccggtcaaccagtcgcatacataaaattgactcctgaggagtacatccgcttt
ttgacaaatcctgtatacttagattttgatactggattttatatttttccccctaccccc
gatggttatctaaaatttgcacgccatggatacggatttacgagaatgcaaaatcttaaa
tccggaaaagtcgaatctgttccaccaaagaaacctctcgtttctcctatcctgcccaag
gaagcggaattagatttacgcagaaaccttcaacgtacttatggcgaagaaattagtcaa
aggccattttacaaaacccgtatttgttattataccgacacagccgatgccgagtttgta
tttgattatcatccagattatgaaaatctgtttgtatgcacaggtggttcaggccatgga
ttcaaattctttccaatcctcgggaagtatagcatagggtgtatgtttcgtgagttagag
gagcccttattgaagaagtggagatggaagaaagaaaatttggagtttgctgctttagac
cacagccgagctggaccctctcgacaagagctaagctaa

DBGET integrated database retrieval system