KEGG   Schizosaccharomyces pombe (fission yeast): SPBC359.01
Entry
SPBC359.01        CDS       T00076                                 

Name
(RefSeq) amino-acid permease
  KO
K16261  yeast amino acid transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC359.01
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPBC359.01
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 2540923
NCBI-ProteinID: NP_595051
PomBase: SPBC359.01
UniProt: Q9P5N4
Position
II:105128..106873
AA seq 581 aa
MSHSDYNFDIEQNAFEKEAPKVSIERKGDVVEEEVIATGEVENYAEPKSRNFLQRFFDDF
KPALTTRGDGVALKRKLTSRHMQMISVGGAIGSGLYVGSGSAFADGGPASVIINYILIGI
MMIFVIYALGELAIAYPVAGSFNTYATRFIDPAWGFAVSWNYFLNYFVTCPLELTTCAIT
FKFWTEINSAAWISIFLAVVIVINLFGVRAYGEVEFILSTIKVIATVGFIILAIIINCGG
VPTDHRGYIGGSIIKQKPFRHGFKGFCSVFTTAAFSFSGTEIIGLAAAEVGNPRKSVPSA
VKQVFWRIAIFYVVSLILIGLLVSPDDPRLMGNGDVSVSPFVLAIQEANIKGLPSVFNAV
IIISVVSVTNSTTYTAARTLQGMATLKQAPKFFSYTDRVGRPLIAMVVVLLFGFFAYINE
ADKNGSDISDTVFDWLLAISGLSSFFTWGSICLSHIMFRLAFKKQGHSLKELGFVSPMGI
WGSVIGLGFNILCLMAEFYVSLFLIGGSPNANDFFQGYLAACIALAFFIGYKIYDRSHIP
SLDKLDIDTGLKTYDNQDEEKEEYSSKGPLNILKKAWNAVC
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtcacatagcgattacaatttcgatattgagcaaaacgcttttgaaaaggaagcaccg
aaggtgtccatcgaaagaaaaggagatgtcgttgaggaagaggtaatagctaccggcgaa
gtcgagaattatgctgaaccaaagagtagaaactttttgcagagattttttgacgacttt
aagcctgctttaacaactcgtggtgacggtgtagcactgaaacgaaaattgacatccaga
cacatgcagatgatttcggttggaggagccattggtagtggtctgtatgttggttcaggc
agtgcattcgcagatggcggcccagcctcagtaattatcaattatatcttaattggaatt
atgatgatttttgttatttacgctctcggcgaattagcaattgcttatccagttgctggc
agttttaatacttatgcaacgcgcttcattgatcctgcctggggatttgctgttagctgg
aattactttcttaattattttgtcacgtgtccattggaactaacaacgtgtgccattact
tttaaattttggacagaaattaatagtgcagcgtggattagcatttttttagcggttgtt
attgtcatcaatctttttggagttcgtgcatacggagaagtggaatttatattgagtact
attaaagtaattgctaccgttggtttcattattttagccatcattattaactgtggaggt
gtaccaaccgaccatcgaggatatattggtggcagtattatcaaacaaaaaccatttcga
catggattcaaaggattttgttcagtttttaccactgctgctttctccttttctggaact
gaaattattggactggcagcagccgaagttggtaatccaaggaaatccgtacccagtgct
gttaaacaagtgttttggcgtattgctatcttttatgttgtctctttaatattgattgga
ttgttggtcagtccggatgatcctagattgatgggcaacggcgatgtcagcgtttcacct
tttgttctagctattcaagaagctaatattaaaggtcttccttctgtttttaacgctgtc
attattatttcggtagtttcggtaaccaattctactacgtacactgcagctcgtaccctt
caaggtatggcaactctcaagcaagcacccaagtttttttcttatactgatcgagttggc
cgtcctttaatagccatggttgtggttctcttatttggcttctttgcatacattaatgaa
gccgacaaaaacggaagcgatatcagcgacacagtgttcgactggttactagcaatctca
ggattgtcaagcttttttacttggggaagtatatgtttatctcatattatgttccgttta
gcatttaagaagcaaggtcattccttaaaggagttgggatttgtgtctcccatgggaatc
tggggttcagtcattggattgggtttcaacatattatgtttgatggctgagttttatgta
tctctgttcctcataggtggtagtccgaatgctaatgatttctttcaaggatatctagct
gcctgcattgctttagctttttttattggttacaagatttacgacagatcgcatattccc
tctttggataaactagatatcgatactggacttaaaacttatgacaaccaagatgaagaa
aaagaagaatattcttccaagggtcctctaaacattttgaaaaaagcatggaatgccgtt
tgctga

DBGET integrated database retrieval system