KEGG   Schizosaccharomyces pombe (fission yeast): SPBC359.03c
Entry
SPBC359.03c       CDS       T00076                                 
Symbol
aat1
Name
(RefSeq) amino acid permease
  KO
K16261  yeast amino acid transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC359.03c (aat1)
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPBC359.03c (aat1)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 2541042
NCBI-ProteinID: NP_595053
PomBase: SPBC359.03c
UniProt: Q9P5N2
Position
II:complement(111309..113048)
AA seq 579 aa
MSAKDYDFDIESVLPEEKAPQVSEAKKDYISQESTVLSGQVDFVEPEHKGFFQNLIDGFK
PAREADGNGGPALKRGLSTRHMQLMSIGGAIGSGLYVGSGSALADGGPASVIINYILIGI
MMFFVIYALGEMAVAYPVAGSFNTYATRFIDPAWGFAVSWNYFFNYFVTFPFELTTCAIT
FTFWTDVNCAVWISIFLVVVIGINLFGVRVFGEVEFVLALIKVVATVGFIILAIIINCGG
VPTDHRGYIGGSIIKQKPFRHGFKGFCSVYTTAAFSFSGTEIVGLAAAEVGDPRKTLPGA
VKQVFWRVAIFYIVSLILIGLLISPDDPKLMGNGSASVSPFVLAIQEANIKGLPSVFNAV
IIISVISVTNSSTYTAGRTLHGMANLKQAPAFFKYTDRLGRPLIAMIVVLSFGFFAYINE
ANNNGNDISDTVFDWLLAISGLSNFFTWGSICLSHIMFRLAFKKQGHSLKELGFVSPMGI
WGSVIGLGFNILCLMAEFYVSLFPIGGSPNANDFFQGYLAACITLVFFIGYKIYDRSHIP
SLDKLDITTGLKTYEYEETKDSSDTGRFRFFKKIINTVC
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgtcagctaaagattatgacttcgatattgaaagcgttttgcctgaagaaaaagctcca
caagtctcagaggccaaaaaggattatatttcccaagaatcgacagttttgtctggccaa
gttgattttgtagaacctgagcataaagggttttttcaaaacttaatagatggctttaaa
ccagccagagaagctgacggtaatggaggtcccgcattaaaacgaggtttaagtacgagg
catatgcaattgatgtctattggcggtgctattggtagtggtttgtatgttggttcagga
agcgctttggccgacggtggtccagcttcagtgatcattaattatattttaattggtatt
atgatgtttttcgttatttatgctctgggtgagatggctgtcgcgtatccagttgccggc
agttttaatacttatgcaacgcgcttcattgatcctgcctggggatttgctgttagctgg
aattatttttttaattattttgttacattcccatttgagttaacgacttgcgcaattacg
tttacgttttggacagatgtcaattgtgcggtttggattagtatttttttggttgtcgtt
attggtattaaccttttcggtgtccgtgtttttggagaagtggagtttgtattagctctg
attaaagtggtcgctaccgtcggtttcattattttagccattattattaactgtggaggt
gtaccaaccgaccaccgaggatatatcggtggcagtatcattaaacaaaaaccatttcga
catggatttaaaggattttgttctgtgtataccactgctgctttctccttttctggaact
gaaatcgttggactggcagcggctgaagtcggcgatccaagaaaaacactacctggtgca
gtgaagcaagtcttctggcgagtagctatattttatattgtttccctaatcttgatcgga
ttgctcattagtcctgatgatcccaaattaatgggcaacggatcagcaagcgtttcacct
ttcgttcttgctattcaagaagctaacattaaaggtcttccttctgtttttaacgctgtt
attattatttccgtaatatccgtgacaaattcaagtacgtatacagctggtcgtaccctc
catggtatggcgaatttaaagcaggcacctgcatttttcaagtacaccgaccgtctgggt
cgtcctttaatagcaatgattgtggtcctttcatttggattcttcgcttatattaatgaa
gccaataataatggaaacgatatcagtgacacagtgttcgactggttactagcaatttcc
ggtctttccaacttcttcacttggggaagtatatgtttatctcatattatgttccgttta
gcatttaagaagcaaggtcattccttaaaggagttgggatttgtgtctcccatgggaatc
tggggttcagtcattggattgggtttcaacatattatgtttgatggctgagttttatgta
tctctgttccccataggtggtagtccgaatgctaatgatttctttcaaggatatctagct
gcctgcattactcttgttttcttcattggttacaagatttacgacagatcgcatattccc
tctttggataaactggatatcaccactggtttaaaaacatatgaatatgaagaaacgaaa
gattcttctgataccgggagattccgttttttcaaaaaaataattaataccgtttgctaa

DBGET integrated database retrieval system