KEGG   Schizosaccharomyces pombe (fission yeast): SPBC359.05Help
Entry
SPBC359.05        CDS       T00076                                 

Gene name
abc3
Definition
(RefSeq) multi drug resistance-associated protein abc3
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1 [EC:7.6.2.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:spo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPBC359.05 (abc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC359.05 (abc3)
Enzymes [BR:spo01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.3  ABC-type glutathione-S-conjugate transporter
     SPBC359.05 (abc3)
Transporters [BR:spo02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    SPBC359.05 (abc3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_23 AAA_29 MMR_HSR1 IstB_IS21 RsgA_GTPase AAA_16 Dynamin_N DUF87 AAA_15 Coilin_N
Motif
Other DBs
NCBI-GeneID: 2540937
NCBI-ProteinID: NP_595055
PomBase: SPBC359.05
UniProt: Q9P5N0
Position
II:122747..127144
Genome map
AA seq 1465 aa AA seqDB search
MITANKGLSLVLLIPNLFALVSGGLQYVFDVRRRIFRPHFSQFWTIWMKFFSIALVIITQ
IYVGYKTKNIGWNFFSVVTYCFVLFLQFAEQSTLRVPMASLLIFWLLKVVTSLLILLFSP
YIAITSMARLLTLITLFCSLVCFISEVYVPPCNRVWYSDDTNEVEEKGIRPSEVRYANIF
SKLSFSWISSFIKFGYTNYLKESDVWLLPPDERSGNLIIGFEDWWIYHSKNKRRSLFLWK
LLFFNHWKLVALITITKLIQDVLAFVQPTLIQKTILFISSYTSPNPESPSRGFIIAILVL
VANFLQTLLLQQYNQLIMLLGMRWKTELLASIYRKSLLLSSSARQNRSIGDIINYMAVDT
QKISDLPIYLFIIVSGPFQIALALSNLYHLMGYSAFTGVAASVILFPCNIIVANVYKKFQ
SILMKNKDSRSKLMTEIINNIRSIKLYAWETPFLQKLLHIRNTKELSMLKKIGFITAIGD
FAWIFTTIIVTTVAFGAFIIFHGKTQALTADIVFPAVSLFNLLQFPLAMLPTVISSLLEA
SVSVSRIYEFLIAQELDYNGVQRFPATEIPHEICLEIKSGTFSWSKKTLKQQVTPTLRQI
NFVAKNGELTCIFGKVGAGKSSLLEACMGNMYKNSGSVFQCGSLAYAAQQPWIFDATIRE
NILFGSEFDPELYEKTIHACCLKRDFEIFTEGDQTEVGQKGASLSGGQKSRISLARAIYS
QADIYLLDDVLSSVDQHVSRDLIKNLFGPEGFLRTHCVVLTTNSLNVLKEADSIYILSNG
KIVEKGNYEHLFVSTNSELKQQLSEFNDEKDTQPLPEHTTSYPSTQISLAPSIHVEGLET
YSSSERKDSSNKYKSRKRNPIRQKVTEDDKGKCVAQTDELVQRGKVKWHVYWMYFKSCSI
GLILLYFFFIISGIMMNVATNVWLKHWSEENGKSSSELNPSPYFYLGIYLFFGFLSCAFI
SSSSLTMTVLCGIRSGRYLHDSMLKTILRAPMGFFETTSSGRILNRFSNDVYKVDEVVSL
TFMFFFRNSIQVLFILGVICYSAPLSLLLIVPLFFLYLYNRAYYVRTSRELKRLDNVTRS
PLYAHVQESLSGLSTIRAYGMQETFVEENDLRIDTNHRVWFMFFSSSRWQAIRVECIGDL
IIFCTAFYGILSAIKGSPNPGLVGFSLSYAIQITQGLSFIVQQSVDAENNTVSVERILEY
INVKSEAPEIIPENRPPCEWPTDGAVSFNHYSAKYREDLSFALNNINIEISPREKIGIVG
RTGAGKSTLAMALFRIIEPTEGKIEIDNEDITKFGLYDLRSRLSIIPQESQIFEGNIREN
LDPNHRLTDKKIWEVLEIASLKNCISQLEDGLYSRVAEGGANFSSGQRQLICLARVLLTS
TRILLLDEATASVHAETDAIVQQTIRKRFKDRTILTVAHRINTVMDSDRILVLDHGKVVE
FDATKKLLENKDSMFYSLAKESGLI
NT seq 4398 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgcaaacaaaggcttgtctctggttttgcttatcccaaatttattcgcttta
gttagcgggggcttacaatatgtttttgacgttaggagacggatctttcgtcctcacttt
tcgcaattttggaccatctggatgaagttcttttcgatagcacttgttattattacacaa
atatatgtgggatataagacaaaaaacatcgggtggaattttttttcagttgtaacttat
tgtttcgtattatttttacagtttgctgagcaatcaactctaagagttcccatggcttct
ctattgatattttggcttctgaaagtagttacctcacttttgattttgttgttcagtccc
tatattgcaattaccagtatggctcggttgcttactttaattactctgttctgctcgctc
gtatgctttattagtgaggtttatgtcccgccttgcaatcgtgtctggtattctgatgat
acaaacgaagttgaagagaaggggataagaccttctgaagttcgatatgcgaacatattc
tcaaagttatcattttcttggatcagttctttcataaaatttggttacactaactattta
aaggaatctgatgtttggctacttcctccagatgagcgatctggcaatttaataattggt
tttgaagactggtggatataccattcgaagaataaacgaagaagtctgtttttatggaaa
cttttattttttaatcattggaaacttgtagctctaattaccatcacaaagttgattcaa
gatgtacttgcttttgttcagccaacattgattcagaaaaccattctctttattagttct
tatacttctcccaatcctgaatccccaagtagaggttttataatcgctatcttggttctt
gtcgctaatttcctccaaactttattactacaacaatataatcagcttattatgttgctt
ggaatgagatggaaaacggaactacttgcatctatttatcgtaaatctcttcttctatca
agttcagcacgccaaaatcgatctattggtgatataataaattacatggctgtcgatact
caaaaaataagtgatctgccgatatatttattcattattgtttcaggtccatttcaaatt
gctttagctctttcaaatttataccaccttatgggatatagcgcttttacgggtgtcgct
gcatccgttatactatttccatgcaacattattgtcgccaatgtgtacaagaagtttcaa
agtattttaatgaaaaacaaagattcccgttccaaattgatgaccgaaattatcaataat
atacgcagtattaaactttatgcatgggaaaccccattccttcagaagctactgcatata
agaaatactaaagaattaagtatgttaaaaaaaattggtttcatcactgcaattggtgat
tttgcctggatttttactaccattattgttacaactgttgcttttggagcctttattatt
ttccatgggaaaactcaagctctcactgcggatatagtatttcctgctgtaagtcttttc
aacctgttgcaattcccattggccatgttacccacagtaattagttctttgttggaagca
tctgtatccgtttctcgaatatatgaatttctcatagcacaagaattggattacaatggg
gtacaacgatttcccgctacagagattcctcatgaaatttgtcttgaaattaaaagtggc
accttcagttggtctaaaaaaacactaaagcaacaagtaacgccaactttacgtcaaatt
aattttgtcgcaaaaaatggtgagctgacttgcatatttggcaaagttggagcgggtaag
tcttctttgctagaagcatgtatggggaatatgtataaaaattcaggttctgttttccaa
tgtggttcactagcttatgcagctcagcaaccatggatctttgatgcaactatccgggaa
aacattctcttcggatctgaatttgatcctgaattgtatgagaaaaccattcatgcatgc
tgcttgaaacgtgattttgaaatatttactgaaggggatcaaacggaagtcggccaaaaa
ggtgcatcgctgtcggggggtcaaaagtcgagaatctcacttgctcgtgcaatatattct
caagcagacatctatcttctcgatgatgttttgtcttccgtagatcagcatgtaagcaga
gatttaattaaaaatctttttggtccagaaggtttcttgaggacgcactgtgttgttctt
acaacaaattctttaaatgtgcttaaagaagcagactcaatttatatattaagcaatgga
aaaattgttgaaaaaggaaactatgagcacttatttgtctcgacaaattctgagctaaaa
caacaactatcggagttcaacgatgagaaggacacgcagcctttacccgaacatactaca
tcgtatccaagtactcaaatttctttggctccttcaattcatgtcgaaggcttagaaacg
tattcttcaagtgaaagaaaagatagttctaataagtataaatctagaaagagaaatccg
atccgccaaaaagtgacagaagatgataagggaaagtgtgttgctcaaactgatgaactt
gttcaacgcggtaaggttaaatggcatgtatattggatgtattttaaatcatgttccatc
ggcttaattttactatacttcttcttcataataagtggtataatgatgaacgtcgcaacc
aatgtttggttgaaacattggagtgaagaaaatggaaaatcaagttcagaacttaaccct
agcccttatttctatcttggaatttatttattttttggatttttatcatgtgctttcatt
tcaagtagtagcttgactatgacggtgttgtgcggtatacgaagcggtcgatatttgcat
gattcaatgcttaagacgattttgcgtgctccgatgggcttttttgaaaccacgtctagt
ggaagaatcttaaaccgattttcgaacgatgtatacaaagttgatgaagtagtttcgttg
acatttatgtttttctttcgaaattcaattcaagtgctcttcattttgggagttatctgc
tattctgcaccattatctttacttctgatagttcctctgttttttctgtatctttataat
agggcttactatgtgcgaacttcacgtgaattaaaaagactagataatgtcaccagaagt
cctttatacgcacatgttcaagaatcattaagcggtttatcaacaatccgagcgtacggt
atgcaagagactttcgttgaagaaaatgacctacgaattgataccaatcatcgtgtatgg
ttcatgtttttcagttccagtagatggcaagctattcgagtggaatgcattggagactta
atcattttttgtacagcattttatggaatcctttctgcaattaaaggtagtcccaacccg
ggcttagtgggtttttcgctgtcatatgcaatacaaattactcaaggtctctcatttata
gtgcagcaatctgttgatgctgaaaataacactgtttctgtagagagaattctagaatac
attaatgttaagagtgaagcaccggaaattattccagagaatcgaccaccttgtgaatgg
cccactgatggggcagtctctttcaatcattatagtgctaaatatcgtgaggacttatcc
tttgctttaaataacattaacattgaaatttccccacgggaaaagatcggtatcgtcggt
cgcaccggggcaggaaaatcaactttggcgatggcattgtttagaataattgaaccaact
gaaggaaaaattgaaatagataacgaagacataacgaaatttggattatacgacttgcgc
tcgcgattatctatcattccacaagaaagtcaaatatttgagggcaacattcgagaaaat
cttgatccgaatcatagactaactgataaaaaaatttgggaggtattagaaattgcttct
ctaaaaaactgcatttctcagttggaagatggattgtattctagggttgctgaaggaggt
gcaaatttttcgtctggtcaacgccaattaatatgtttagcaagagttttacttacttcg
acccgtatattattgctggatgaggcaacagcatcagtccatgctgaaactgatgctatt
gtacagcagaccattcgcaaacgcttcaaagatcgtacaattttaacagttgcacataga
attaatacggtaatggattcagatcgcatcttagtcttagatcatggaaaagtggttgaa
tttgatgcaactaaaaaattgttggaaaacaaagactcgatgttttattcgttggctaaa
gaaagcggtctcatttaa

DBGET integrated database retrieval system