KEGG   Schizosaccharomyces pombe (fission yeast): SPBC359.06
Entry
SPBC359.06        CDS       T00076                                 

Gene name
mug14
Definition
(RefSeq) adducin
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-GeneID: 2540926
NCBI-ProteinID: NP_595056
PomBase: SPBC359.06
UniProt: Q9P5M9
Position
II:128825..129598
AA seq 257 aa
MAKVTGLPEFEDLHTKRKWMLNHMAAAFRMFGRNGYNEGTAGHVTVRDPIDENTFWINPL
EVPFSLMKPSDLVHINSDGEIIGGSKMKYNTSGFAIHYEMHKVRPEVICVCHVHSIYGKA
FSALGKPLDMLNTDCCVFYNNHGIYFDMDDVISMPEEGRRTAKGLADYKAVLVQNHGIMT
VGTTVDEAAYLLSLMERSCQIQLLIDSATKVGERKHVHPTRAKAIRENADNPVGLYTAQQ
PNFLYEVACSNGELEII
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctaaagtaactggattgcctgaatttgaagacttacatactaaaagaaaatggatg
cttaatcatatggctgcagcttttcgcatgtttggtagaaatggatataatgaaggaaca
gcaggacatgttactgtaagggatccaattgatgagaatactttttggataaatcctttg
gaagtccccttttccttgatgaagcctagcgatttggttcatatcaacagcgatggcgaa
atcattggtggaagcaagatgaagtataatacttcgggatttgccatccattatgaaatg
cacaaagtgcgacctgaggtaatttgtgtttgtcacgtacactcaatttacggtaaggca
ttttcagctttgggaaagccattggatatgttgaacacagactgttgtgtgttttataat
aatcatggaatttattttgacatggatgatgtgatatcgatgccagaagaaggaagacgt
accgctaaaggattagcagattataaagctgttcttgttcagaatcatggcattatgaca
gttggtactactgtggatgaggcagcatatcttctttcattgatggagcgatcatgccaa
attcagttgttaattgatagtgcaaccaaggtgggagaaagaaagcacgttcatcccact
cgtgccaaagctattcgcgaaaatgctgataacccagtgggtctatacactgctcaacaa
cccaactttttgtatgaagttgcttgttcaaatggggaactagaaataatttga

DBGET integrated database retrieval system