KEGG   Schizosaccharomyces pombe (fission yeast): SPBC365.13c
Entry
SPBC365.13c       CDS       T00076                                 

Gene name
hba1
Definition
(RefSeq) Ran GTPase-binding protein Hba1
  KO
K15304  Ran-binding protein 3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Ran_BP1 WH1
Other DBs
NCBI-GeneID: 2540948
NCBI-ProteinID: NP_001342890
PomBase: SPBC365.13c
Position
II:complement(2519571..2520770)
AA seq 399 aa
MTSKMENNKDESISTKNALEEKSNETKDETSKRKHDPAEEESAVSTKVSKSEPLEDKGNA
EVKEFKETTKSNGVKPEVEITESTKIQKESNTEPCISTGGKVEEKELKVNKDVDENEGHV
AVETGKKESAAKPAASVSPFSQFASFSNASSPFSNVSTASSEPKEEKSAFGAFASSKSAF
TMKSVKDSPFKKFAAGTAVETESGSGKEKENDKKSSENFDELLANTSAKAFENQKGSAGE
TKSEPKEADKGSGDSTKSTMHQLSDSEIITGEEEEESIFSVRARLYVVADEKKTWKERGQ
GILKVNVPKQRGSGSGRLLMRNDAVHRVIMNVPLFQGMSKKSLQIASASSGGSANYLKIF
VIENGKSVLYAVRVKDNSLAEQLRNHVLEAIPKGGREDA
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaccagcaaaatggaaaataataaagatgaaagcatttctaccaaaaatgcgttagaa
gaaaaatcgaacgaaacaaaagacgaaacttcaaagcgaaagcacgatccggcagaagaa
gaatcagcggtttccactaaagtctcgaagagtgaaccgctggaagataaagggaatgct
gaagttaaggaatttaaagagactacgaagagcaatggcgtaaaaccggaggttgagatt
actgagtctactaaaatccaaaaggaatcaaacacggagccatgtatctcaactggaggt
aaggtagaagaaaaagaattgaaggtgaataaggatgttgatgaaaatgagggacacgta
gctgtagagacaggcaaaaaagaatcggctgctaagcctgccgcgagtgtttctcccttt
tcacaatttgcttcattctctaatgcctcgtctccattctccaatgtttcaaccgcctcc
tctgaaccaaaagaagagaaatcagcatttggtgctttcgcttcttcaaagtcagcgttc
acaatgaagagcgttaaggatagcccatttaaaaagtttgctgcaggaacagcagttgaa
acagaaagtggttctggcaaagaaaaagaaaatgataaaaagagttcagagaactttgac
gagttacttgcgaatacgtcagccaaagcattcgagaatcagaaaggttcagctggtgaa
accaaatcggaacctaaggaggctgacaagggtagtggagactcaacaaagtctactatg
catcagttgagtgattcagaaatcatcactggggaggaagaggaggaatcaatattcagt
gttcgcgcaagactttatgttgttgctgatgaaaaaaagacttggaaggaacgtgggcag
ggaattttgaaagtaaatgttcccaagcaaaggggatcaggctcaggccgccttttgatg
agaaatgatgccgtgcatcgagttataatgaacgtgcctcttttccaaggcatgtcgaaa
aagtcattacaaattgcatcagcatctagtggtggttctgctaattacttaaagatcttc
gttattgaaaatggaaaatctgtgttatatgctgttcgtgtcaaagataacagtttggca
gaacaactacgcaatcacgttttggaagccattcctaagggtggaagagaagatgcatga

DBGET integrated database retrieval system