KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3B8.02
Entry
SPBC3B8.02        CDS       T00076                                 

Gene name
php5
Definition
(RefSeq) CCAAT-binding factor complex subunit Php5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone Flu_PB1
Other DBs
NCBI-GeneID: 2540133
NCBI-ProteinID: NP_596412
PomBase: SPBC3B8.02
UniProt: P79007
Position
II:complement(join(3394350..3395222,3395281..3395310,3395356..3395700))
AA seq 415 aa
MNSIPDSYSLKQGFPEGLGEYVDPSGNPNSQVRIGYGQDSVSRFQQPVPDVDPTAVNHYN
ASAPIEVASPFDNVTQGLVGSDAQALAEYWQKTIDTLEHDDQAVKTLHLPLARIKKVMKT
DDDVKNKMISAEAPFLFAKGSEIFIAELTMRAWLHAKKNQRRTLQRSDIANAVSKSEMYD
FLIDIISKDNNNSRASSSQAHMSATQVAAMGGMNGLQPFPTQAGLPNQGFPMPTGSQLPF
SNQQSSQPSMQYSSHPSRMQQMQDIDQSMYKQQRLGSEYPQLQMSDNSGNVNQMNMQRPV
MVAPYMAEHLYRYPPTHLESGSSAFRLQSSPMGYQMPQFQGNMRPNMQQSQMFDPSAYGM
SRRPGSPRQFDQQQRLYSQPNAMMYQTQQGRQGNPMHQQFSQQQNPLSRYSQQPQ
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaattctattcctgattcctattccttgaaacaaggctttcccgaaggtttaggagaa
tatgttgatccctctggcaatcctaattctcaggtacggataggttatggtcaagattct
gtttctcgcttccaacaaccagtccccgatgttgatccaactgctgtcaatcactacaac
gctagtgcacccattgaggttgctagtccatttgataatgttactcaaggtcttgttggc
agtgatgcacaagcccttgctgaatattggcaaaaaaccatcgatacattggaacatgac
gatcaagctgtaaaaactctgcatcttcccttagctcgtattaagaaagttatgaaaact
gacgatgatgtgaagaataaaatgatctcggcagaagctccttttctgttcgctaaagga
agtgagatatttattgcagagcttactatgagggcttggcttcatgccaaaaaaaatcaa
cgaaggacactacaaagatccgatattgcaaatgcagtatcaaaatctgaaatgtatgat
ttcttaattgatattatatctaaagataacaataattcccgcgcatcttccagtcaagct
catatgtctgctactcaagttgctgctatgggtggtatgaatggtttacaacctttcccc
actcaagctggcttacccaatcaagggtttccaatgccaactggtagtcaacttccattt
tcaaatcaacagtcaagtcagccttcaatgcagtattcctctcatccatccagaatgcag
caaatgcaagatattgatcaatctatgtataaacagcagcgtctgggctctgaatatcca
caactacaaatgtcagataactccggaaatgttaaccagatgaatatgcaaagaccggtc
atggtagcaccgtacatggctgagcatttataccgttatccacctacgcatctcgaatct
ggatcctcagctttccgattgcagtcatcccctatgggatatcaaatgccccaatttcaa
ggtaatatgcgacctaatatgcaacagtctcaaatgtttgatccttctgcatatggtatg
tcaagaagacctggatctcctcggcaattcgatcagcaacagagactttattcacagcca
aacgctatgatgtatcaaactcagcaagggcgtcagggaaacccaatgcatcagcagttt
tcccagcaacaaaaccctctttctcgctattcgcaacaaccccagtaa

DBGET integrated database retrieval system