KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3B9.16c
Entry
SPBC3B9.16c       CDS       T00076                                 

Gene name
nup120
Definition
(RefSeq) nucleoporin Nup120
  KO
K14303  nuclear pore complex protein Nup160
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    SPBC3B9.16c (nup120)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPBC3B9.16c (nup120)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC3B9.16c (nup120)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     SPBC3B9.16c (nup120)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    SPBC3B9.16c (nup120)
SSDB
Motif
Pfam: Nup160 PA28_alpha
Other DBs
NCBI-GeneID: 2540505
NCBI-ProteinID: NP_596674
PomBase: SPBC3B9.16c
UniProt: O43044
Structure
PDB: 
4GQ2 4FHM 4FHN

Position
II:complement(4015357..4018767)
AA seq 1136 aa
MNELKHAVVPIDLQSFCLEGTLALWVPALENDSEDDSEAIETADDNEKLFKKECVAYDAG
VYTSNKSKGSQTLRWSIFQNRTLTIFDVSLNSKKEPLSKFNVKIHFPSNVMKDGVAFSFS
EHSDTTIIYAITHARVLYYIRLSKTWFQLPDARLDDDWCLCYRPISFLNQKPDLMAAIST
SEICVSFFNGGLTKIILNPKDASHYEQHIDDSSYLFSLKKYLSLQAFKADYRSPNTIISM
IFLSTYNVLVMLSLDYKLKVLDLSTNQCVETIELSQTILPLQSFPYLTSDHTTNSFIALY
YPDNSHGSFSIYKLNANAHSFKLNVVIEKGIIPPSLPDDEFIPWMLSDFQLISSEGSQSK
FLLIIAWKSNLNTVIQKCNLSLDQDESFSCVWSHSLDSFSLIEKTFFDVPTNMSSGDISE
IWLQHIFAHNTSIESIQVALLSFQNSSSQVSKNKLDKFGALTISELKNAVLSSIVSTIQI
EPNSDLTGYDYYEYKRLLYNEWERFAKLVAYLDHFGDEILSINFDPSNAVTYINYANKVA
FIRDPYLIESFDEEPLTKLISSLETDDPSLIEGYQILDLGRSLHSCMSFSTLSEIRYSLR
ELVQDLPSYSLFDTLWVFYDKHIYPNVDPDYISTLIDTLVSLENPMRDIDSLIQRLRSFD
IYNHSAQSPSLFLCASVARVLDSILKKFQVSIEGFIFLLSLITSQQDYELQSKFAGCDKL
FLSLLEDWRLVSFLLENSALLLEKFEEEDVDSTNCNLNTMEALASVNTALQFFSALNYSE
CFSESQISPLHATVISSLSAIFIRDDTENDLVTELVEKLFLFKQYNACMQLIGWLNSDPI
AVYLKALIYLKSKEAVKAVRCFKTTSLVLYSHTSQFAVLREFQEIAEKYHHQNLLSCYYL
HLSKKLFEESAYIDALEFSLLADASKETDDEDLSIAITHETLKTACAAGKFDAAHVALMV
LSTTPLKKSCLLDFVNQLTKQGKINQLLNYSMPTLRQDVDNLLERKAFQMINVESQPCWY
NILFSWRYKHQNYRDAAAIIYEKLSRYISTTELIGKKERTFIIEHYLIVLNTLELLPKED
TWILVTDMSVDKEPDPNFLPQKLLTLDAIVAEYHLQLKDVAVQVTAEMSSAMNIDL
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgaatgaattaaagcatgcggtagttccgatagacttacaatctttttgtctggaagga
actttggcgttgtgggttccagctctcgaaaacgactcggaagacgattctgaagctata
gaaacagctgatgataatgaaaaactttttaaaaaggaatgtgtagcatatgatgcaggt
gtttatacctcaaataaaagcaaaggttcacaaactttacgatggagtatattccaaaac
agaacactcactatctttgatgtttcattaaattctaagaaggagcctttatcaaaattt
aatgtgaaaattcattttccatccaacgtaatgaaggacggtgtagctttctcgttcagt
gagcattccgacacgaccattatatatgctattactcacgctcgcgttttgtattatatt
agattatctaaaacttggttccaattaccggacgctcgcttagacgacgattggtgtctt
tgttaccgaccaatatcctttctgaatcaaaaacccgatttaatggccgcaattagcacg
tctgaaatttgtgtaagctttttcaatggaggtttaacaaagattatattaaatccaaaa
gacgctagtcactacgaacagcatattgatgattctagttatttgttttccctaaaaaaa
tatctatcacttcaggcatttaaggcagattaccgctctcctaatactattatttcaatg
atttttttgtctacctataatgttcttgtgatgctatcgcttgactataagttaaaagtt
ttggatttgtctactaatcaatgcgtcgaaaccattgaactgtcacagactatacttcct
ctacaatcctttccttatttaacttcagatcacaccactaattctttcatcgctctgtat
tacccagataattctcatggctctttttcaatttacaaacttaacgcaaacgcccactct
tttaaattaaatgttgtcatcgagaagggcataattcctccttctttaccagacgatgag
ttcataccatggatgctttctgattttcaactgatatcgtcagagggctctcaatctaaa
tttttgctcattattgcttggaaaagcaacttaaataccgttatccaaaaatgcaacctt
agtctagatcaggacgagagtttttcatgcgtttggagtcactctttggatagcttttcc
ctcatagaaaaaaccttttttgacgttccaacaaacatgtcgtctggggatatctcagag
atttggctacaacacatttttgcacataatacatctattgagtctatacaagttgctctt
ttaagctttcaaaacagctcctcgcaagtttcaaaaaataaactggataaatttggcgca
cttactataagtgaacttaaaaatgccgttttgtcgtctatagtttcaacgatccaaata
gagccaaattcagatttaactggatacgattattatgaatataagcggctattatataat
gaatgggaaaggtttgcgaaacttgttgcatatctggatcattttggagatgaaatatta
agtattaacttcgatccttcgaacgctgttacatatatcaattatgcaaataaagtggct
tttattagggatccttatctcattgaatcctttgacgaagagccgttgaccaaattaatt
agttcccttgaaacagatgatccttctctaattgaaggttatcaaattctggatcttggt
aggagtttacattcctgtatgtcattttctactttatctgaaattagatactcattacga
gaactagtccaggatttgccatcttattctttatttgatacattgtgggtattttatgac
aagcacatatatcccaacgtcgatccagattatatcagtactttaattgatactctagtt
tctcttgaaaacccgatgcgcgacattgattctcttatccaacgcttaagaagtttcgat
atttacaaccattccgctcaatccccttccttatttttgtgtgcatcggtagcacgggtt
ttggacagtattttgaaaaagtttcaagtctctattgaaggatttatttttctactttct
ttgataactagccagcaggattatgagttacaatccaaatttgcaggatgtgataaatta
tttctttctttactagaagattggcgtcttgtgagttttcttttagagaattctgcactt
ttgctagaaaaatttgaggaggaggatgttgattcaacaaactgtaatttaaatactatg
gaagctttagcaagtgttaacacagcccttcagtttttttccgctttgaattattccgaa
tgtttctcagaaagccaaatttcacctttacatgctaccgtgatatcgtctttgtcggca
atctttataagggacgatacggaaaatgatctggtcactgaacttgtagaaaagttgttt
ctattcaaacaatataatgcatgtatgcaattaatagggtggcttaactctgacccaatt
gcagtctacttgaaagcacttatttatctcaaatcgaaagaagctgttaaggctgtccga
tgtttcaagactacttctctagtcctttactcacatacttctcaattcgcagttttacgg
gagtttcaagaaattgctgaaaaataccaccatcagaacctattatcgtgttattacctt
catctatcaaaaaagctgttcgaggagagtgcatatatagatgcattagaattttcttta
ttagcagatgcctcgaaagagactgacgacgaagatttgtctattgcaattacccatgag
actttaaaaaccgcttgtgcagcaggaaagtttgacgctgctcacgttgcattgatggtt
ttatccactacgcctttgaaaaagtcatgtttactagactttgtaaatcaattaacgaaa
caaggtaaaataaatcagcttctaaattattcaatgccaacgttaagacaggacgtcgac
aatttgcttgagcgaaaggcctttcaaatgattaacgttgaatcacaaccatgctggtat
aatattttgtttagttggcggtataaacatcaaaactatcgagacgcagcagcaattatt
tatgaaaaactgagccggtatatctctactacagaattaattggaaaaaaggagagaact
tttataatagaacattatttgattgttttgaacactctggagttgcttccgaaagaagat
acatggattcttgtgacagacatgtccgtggacaaggaacctgaccctaactttcttcca
caaaaattacttactctagatgcaattgtagcagaatatcacttacagttgaaggatgtc
gctgttcaagttacagctgaaatgtcatcggccatgaatatcgatttataa

DBGET integrated database retrieval system