KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3D6.02
Entry
SPBC3D6.02        CDS       T00076                                 

Gene name
but2
Definition
(RefSeq) But2 family protein But2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: But2
Other DBs
NCBI-GeneID: 2540960
NCBI-ProteinID: NP_595513
PomBase: SPBC3D6.02
UniProt: P87167
Position
II:1269748..1270920
AA seq 390 aa
MQLLNSFLGFAASIAVLASSADAAPTLYKRKSKSNTNTAKSVAILDGVGVNNTFGVISYR
EKFPMDYHIWHTAPSTGKTYLQPWNDAVEPSTYYIDEGTFLRTGLKFAYIGDNMDLAFTN
HTDWKASKHDDGTHRVDLSQRKPANNFMATQRCGKLDPFGYQLKRSKKVFQACGTQVFVG
SGRSIDCQWMDSVALNLSRYYGNTEALSSLPLPRNLSADIPAKSSRLFPHGIYNFNFSAP
NKRMQRFTASEATTVNGQNQSVYLTYDVPYGRSLYYYTSCALEFRFTNEFFPMDVTPNDG
SAQFVVYNMSGNPKKQTTSSKGPTRLYEVARFNCTTRGCEYTQNIPCPRAGHSHTYELAP
ASPNTSISWIQSYSPRIGVTLQVYSNANFD
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgcaattgttaaactcttttctcggtttcgcagcctctatcgctgtccttgcctcttcg
gctgatgccgctcctaccttgtacaagcgtaagagcaagagcaacaccaacactgctaaa
tctgtcgccatcttagatggtgtgggtgtcaacaacacctttggtgttatctcttatcgt
gaaaagttccccatggactatcacatctggcatactgccccctccaccggtaaaacttac
ttacaaccctggaacgacgctgtcgagccctctacctactacatcgatgagggtaccttc
ttgcgtactggcttgaagtttgcttacattggtgacaacatggatcttgcctttaccaac
cacactgactggaaggctagcaagcacgatgatggtactcaccgtgttgacttgagtcaa
cgtaagcctgctaacaacttcatggccactcaacgttgtggtaagcttgatccttttggt
taccaattgaagcgttccaagaaggtcttccaagcttgtggtactcaagtctttgttggt
tctggtcgtagtatcgattgccaatggatggactctgttgccttgaacctttctagatac
tatggcaacaccgaggctcttagctctcttcctttgcctagaaaccttagtgctgacatt
cctgccaagtctagccgtctcttccctcacggtatctacaacttcaacttctctgccccc
aacaagcgtatgcaacgtttcaccgcttctgaagccactaccgtcaacggccaaaaccaa
tctgtttaccttacttacgacgttccttatggtcgctctttgtactactacactagctgt
gccttggaattccgtttcaccaacgagttcttccccatggacgttactcccaatgacggt
tccgctcaattcgttgtctacaacatgtctggtaaccccaagaagcaaaccacctcctcc
aagggccccacccgtctctatgaggttgctcgtttcaactgcaccacccgtggctgtgaa
tacactcaaaatattccctgccctcgtgctggtcactctcacacttacgaacttgctcct
gcttctcctaacacctctatttcttggattcaatcatactctcctagaattggtgtcacc
cttcaagtctactccaatgctaacttcgattag

DBGET integrated database retrieval system