KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3D6.04c
Entry
SPBC3D6.04c       CDS       T00076                                 

Gene name
mad1
Definition
(RefSeq) mitotic spindle checkpoint protein Mad1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04111  Cell cycle - yeast
spo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPBC3D6.04c (mad1)
   04113 Meiosis - yeast
    SPBC3D6.04c (mad1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC3D6.04c (mad1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     SPBC3D6.04c (mad1)
SSDB
Motif
Pfam: MAD Fez1
Other DBs
NCBI-GeneID: 2540320
NCBI-ProteinID: NP_595516
PomBase: SPBC3D6.04c
UniProt: P87169
Position
II:complement(join(1274979..1276897,1276948..1277098))
AA seq 689 aa
MSSKLTVYQATTSMADSPRDPFQSRSQLPRFLATSVKKPNLKKPSVNSANETKNPKLASL
EFQLENLKNDLKRKELEFEREQIELQRKLAEEHEQKNSLQLRLTLVEKQLEEQSTSYQKE
IEEVRNEKEATQVKIHELLDAKWKEIAELKTQIEKNDQALSEKNHEVMVSNQALQMKDTN
LTNLEKLFADSREQLETKCKELAAAEQQLQELSVHNQQLEESIKQVSSSIELEKINAEQR
LQISELEKLKAAQEERIEKLSSNNRNVEILKEEKNDLESKLYRFEEYRDKVATLELENEK
IQTELNSWKSLITNELPTPEAVSNKLVFLQNTNANLGERVSSLESQLSNKPANQPLGANE
KDAAHITELETKLKELHEQNRRLQRQKSLATQEIDLLRENLKSYDDEEAILSEKNTDMKK
LERIEGLVKLVDEYKLKLESMPVSLDVDETSDEVSLQKRRRKNEHKDAGYVTELYRKNQH
LLFQVKEKTNIEAFLREQIITLESSIATLRQELAQVTEINSCRVLQHRSNPTLKYERIKA
AQLEMLNAENSALKALLEDKKVDCLPIQSFKIAERKALDLKKEVAEREKRIQRLKEIFSV
KSLEFREAVFSLFGYKLDFMPNGSVRVTSTYSREDNTAFIFDGESSTMKLVGNPSGPEFE
RLIRFWCDERKTIPGMLAALTLELLDKND
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgagctccaagctgacagtgtatcaagcgactacatccatggcggattctcctagggat
ccgttccaatcgcgttcacagttgcctagatttctagcaacaagcgttaagaaaccaaat
ttgaagaagccttctgttaattctgctaatgaaacaaaaaatcccaaactagcttcttta
gaatttcaactagaaaacctaaaaaatgatttaaagcggaaggaactggaatttgagcgt
gaacaaattgagttgcaaagaaaacttgcagaagaacatgaacagaagaattcgttacag
ctgcgtctaactctagttgaaaagcaactggaggagcagtctacttcttatcaaaaagaa
atagaagaagtaagaaatgaaaaggaagccactcaggtgaagatccatgaactacttgat
gcaaaatggaaagagattgcagagttgaaaacccagatagaaaagaatgatcaagcttta
agtgaaaagaatcatgaagtaatggtctcaaatcaagctttgcaaatgaaggataccaat
cttacaaaccttgaaaaactctttgcggattcccgcgaacagcttgaaacgaagtgtaag
gaacttgcggctgccgagcagcaattacaagagctttcagttcataatcagcaattggaa
gagtccatcaagcaggtttctagttctattgaactggaaaaaataaatgctgagcaacgt
cttcaaattagcgagttggaaaaattaaaagctgcgcaggaagaacgaattgaaaagcta
tcatccaataataggaatgttgaaattctcaaggaagagaaaaacgatttggagtccaaa
ctttatcgttttgaagaatatagggataaggttgctacccttgaactcgaaaatgaaaaa
attcaaactgaattaaattcttggaagagtttaattactaacgagttaccaacccctgaa
gctgtttcaaacaaactcgtgtttctacagaataccaatgctaatctcggagagcgcgtt
tctagtttagagagtcaattgtctaataagcctgcaaaccagccgcttggtgcaaatgaa
aaagacgccgctcatattaccgaacttgaaacaaagcttaaagaacttcatgagcagaac
cgacgtctacaaagacaaaaatctttggcaacccaagaaattgaccttttaagggaaaac
cttaaaagctatgatgatgaggaggcgattttgagtgaaaaaaatactgatatgaagaag
ttggaaagaattgaaggtctggtcaagctggttgatgaatataagctaaagcttgaaagt
atgcctgtatctcttgatgtagatgagacttcagatgaggtctcattacaaaagagacgc
aggaaaaacgaacataaagatgctggttacgtaacggagctatatcgtaagaatcagcat
ttgctttttcaagttaaagagaaaaccaacattgaagcctttctaagggagcagattatt
acattggaatcctccatagcaactttacgtcaagaactggcacaagttactgaaataaac
tcatgtcgagtattacagcatcgatccaatcctactttgaaatatgagaggattaaagct
gcgcaattggagatgctgaatgctgagaactcagctttgaaagctcttttggaagataaa
aaggttgattgtctacctatacaatcatttaaaatagctgaaagaaaggccttggattta
aagaaagaagtagccgagagagaaaagagaattcaacggttaaaggagattttttcagta
aagtctttggaatttcgcgaagctgttttttcgctttttggatataagctcgattttatg
cctaatgggagtgttcgtgttacatccacatattctcgtgaagataataccgcttttata
tttgatggcgaatccagcaccatgaaattggttggtaatccatcaggccccgaatttgag
cgccttatacgattttggtgtgatgaacgcaaaacaataccaggcatgttagcggctcta
acgttagagcttcttgacaaaaatgattga

DBGET integrated database retrieval system